SecReT6
Effector Protein ID: 336126181
SecReT6 ID446
T6SS typeA1
Gene symbol-
Locus tagVAA_01024
StrainVibrio anguillarum 775
Repliconchromosome II [GenBank: NC_015637] [Browse all T6SS(s) in this replicon]
Location [Strand]887464..889374 [+]
Productmono- and diacylglycerol lipase
Effector typeProtein
Homologous effectorVC1418
DescriptionTseL
UniProt IDF7YR50
KEGG IDvan:VAA_01024
PDB IDNA
Domain hit(s) vs Pfam Lipase_3 [PF01764], Evalue: 1.50E-19, Aligned region: 312..428
CarboxypepD_reg [PF13620], Evalue: 0.009, Aligned region: 24..94
Protein Sequence: 636 a.a.     [Download]
>gi|336126181|ref|YP_004578137.1| mono- and diacylglycerol lipase [Vibrio anguillarum 775]
MDSFNHCVQCNPEKNWLELEFMSENDEPIDGLAVTITNKITSNTHTQTTSAGKVLFANIAAGEWRASVSQ
ASLLSEVEKYASRKEGQESPVKIRASAELDAAEQNPKRYHSTTIGDFWDEAPQDEFLQEHHKGIDTNASA
EKAGFSLSHNQSYVFEIKALRSYMPVIIDTDEFSLVNSYTFALLSKLAYATDKKSIDLKSEADSTGSIGT
VINQFKSRQLPIQSGNQKVRWLVEEIPYSRALNFKYYDNRQKHAQGYILFNEEIAIVSVRGTEPSFYDKD
SVIDPNSKFIITKVANGIDAVLNSPGINDLVKTDLDAAQIAPNEFGGAYVHQGFYQYSMALWENTLLADD
ILKNHATKRFYLCGHSLGGAGALLLSALIKDSLHPSVLRLYTYGMPRTGTRSFVTQYQDILHYRHVNNHD
GVAQIPMTWANTDITEGLDKWDVFSSGITLIKKMLTDNDDDNYLHHGHLSQLLTYQKPDQILLTPRQTQV
TMLDMAKLAINDSVSLVNNLSEVSIAEHGMDHYVPNLWQQLLALSNESLMTHYQKAISALDQEIATLQQN
YLTVKQTWARSIGDGTPAMGIGRLMSEMNSINKLIDNRNQIRGELKQIVSDPQRLPLAKLLIAQQTLPDE
IKEQLQ
-
Nucleotide Sequence: 1911 bp     [Download]
>gi|336125405|ref|NC_015637.1|:887464-889374 Vibrio anguillarum 775 chromosome II, complete sequence
ATGGATTCATTTAACCATTGCGTGCAGTGCAACCCCGAGAAAAACTGGTTGGAACTGGAGTTCATGAGTG
AAAACGATGAACCGATTGATGGCCTTGCCGTCACCATTACGAACAAAATTACCTCCAACACACACACGCA
AACCACCAGCGCCGGTAAAGTATTATTTGCAAATATTGCCGCAGGTGAATGGCGCGCTTCTGTCAGCCAA
GCCTCTTTGTTAAGCGAAGTCGAAAAGTACGCCAGCCGTAAAGAAGGGCAAGAGTCGCCAGTGAAAATCC
GTGCATCGGCAGAGCTGGATGCTGCTGAGCAAAACCCGAAACGGTATCACAGCACCACCATAGGTGATTT
TTGGGATGAAGCCCCGCAAGATGAGTTTTTACAAGAGCATCATAAAGGGATAGATACCAATGCCTCTGCG
GAAAAAGCAGGGTTCAGCCTTAGCCACAACCAAAGTTACGTTTTCGAAATCAAAGCACTGCGCAGTTATA
TGCCAGTGATTATTGATACCGATGAATTTAGTTTGGTGAATAGTTATACCTTTGCGTTGTTGTCCAAATT
AGCTTATGCGACTGATAAAAAAAGTATTGATCTAAAATCAGAGGCTGACAGTACTGGGAGTATCGGAACA
GTTATAAATCAGTTCAAGTCTAGGCAGTTGCCGATACAGTCAGGTAATCAAAAAGTGAGATGGCTTGTCG
AGGAAATACCTTACAGCAGAGCGCTGAATTTTAAATACTACGATAACCGCCAGAAACATGCCCAAGGCTA
TATCCTGTTCAATGAAGAAATAGCTATTGTTTCAGTTAGAGGTACTGAGCCGAGTTTTTACGATAAAGAT
AGTGTCATTGATCCAAATTCAAAATTCATCATTACTAAAGTGGCTAACGGCATTGACGCTGTACTTAATT
CGCCAGGTATAAATGACCTTGTTAAAACAGACTTGGATGCAGCACAAATAGCGCCTAATGAATTTGGAGG
GGCCTATGTCCATCAGGGGTTCTATCAATATTCGATGGCGTTATGGGAAAACACACTACTAGCTGATGAT
ATTTTAAAAAACCATGCTACTAAACGATTTTATCTTTGTGGGCATAGTTTAGGTGGTGCTGGGGCATTGC
TGCTCAGTGCATTGATTAAAGATAGCCTCCATCCTTCAGTATTGCGTTTATATACATATGGAATGCCACG
GACAGGAACGCGCAGTTTTGTTACCCAGTATCAGGATATTCTGCATTATCGTCATGTTAATAACCATGAT
GGAGTTGCTCAAATCCCCATGACATGGGCAAATACCGATATTACAGAAGGACTCGATAAATGGGATGTAT
TTAGTAGCGGTATAACGTTGATTAAGAAAATGCTCACCGATAACGACGATGATAATTATCTGCACCATGG
TCATTTATCACAGCTACTGACTTATCAAAAACCAGATCAGATTCTACTAACGCCCAGACAAACACAAGTG
ACGATGTTAGACATGGCAAAATTAGCCATTAATGATTCTGTTTCGCTGGTAAATAATTTGTCCGAAGTAT
CGATTGCTGAGCACGGTATGGATCATTATGTACCTAACTTATGGCAACAGCTGCTTGCTTTAAGTAATGA
AAGTTTAATGACGCATTATCAAAAAGCGATATCAGCTCTCGATCAAGAAATTGCTACTTTACAGCAAAAT
TATCTCACCGTTAAACAAACTTGGGCTCGTTCTATCGGAGATGGCACACCTGCTATGGGAATTGGACGTT
TGATGAGCGAGATGAATTCTATAAATAAGTTAATAGATAACCGTAATCAGATTAGAGGTGAACTAAAGCA
GATAGTCTCTGATCCTCAGCGCTTACCTTTAGCAAAATTATTAATAGCGCAGCAAACATTACCTGATGAA
ATCAAGGAACAACTGCAATGA
 Primer design