SecReT6
Effector Protein ID: 375258638
SecReT6 ID521
T6SS typeN/A
Gene symbol-
Locus tagKOX_09215
StrainKlebsiella oxytoca KCTC 1686
Repliconchromosome [GenBank: NC_016612] [Browse all T6SS(s) in this replicon]
Location [Strand]1957872..1958357 [+]
ProductHcp family T6SS protein Cts2H
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDG8WHI0
KEGG IDkox:KOX_09215
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.90E-40, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|375258638|ref|YP_005017808.1| Hcp family T6SS protein Cts2H [Klebsiella oxytoca KCTC 1686]
MDVIFLKLDNIEGESQAKGFEKQLEIMTFSHNVAMPVTNDVSNNERTSGRAHVGEMSLTKFVDLATPKLN
EYCCSGKMIKEAVLTLCRNDNGKMLPFIIYTLTNVVISHLSVSGGSGGKPVETMSLNFTKIKWEISAQKS
DSQKEGNVSSVWDMATNKKGS
-
Nucleotide Sequence: 486 bp     [Download]
>gi|375256816|ref|NC_016612.1|:1957872-1958357 Klebsiella oxytoca KCTC 1686 chromosome, complete genome
ATGGATGTGATTTTTTTAAAGCTCGACAATATCGAAGGTGAAAGTCAGGCCAAAGGATTTGAAAAACAGC
TTGAGATCATGACCTTCAGCCATAACGTGGCGATGCCGGTCACCAACGACGTCAGTAATAATGAACGCAC
CTCAGGGCGGGCGCATGTCGGTGAAATGTCGTTGACCAAGTTTGTCGATCTCGCGACGCCAAAGCTCAAT
GAGTACTGCTGTAGCGGGAAAATGATTAAAGAAGCTGTGCTGACGTTGTGCCGTAATGATAACGGTAAAA
TGCTGCCATTCATCATATATACCCTGACGAATGTCGTTATCTCACATCTGAGCGTTAGCGGCGGTTCCGG
CGGCAAGCCGGTCGAAACAATGTCGCTGAACTTTACCAAAATTAAATGGGAAATCAGCGCTCAGAAATCG
GATAGTCAGAAAGAAGGCAACGTCTCTTCCGTTTGGGATATGGCGACGAATAAAAAAGGTAGCTGA
 Primer design