SecReT6
Effector Protein ID: 377812346
SecReT6 ID516
T6SS typeA1
Gene symbolhcp
Locus tagBYI23_B001010
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016625] [Browse all T6SS(s) in this replicon]
Location [Strand]128445..128921 [-]
Producthcp protein
Effector typeProtein
Homologous effectorBTH_II0868
DescriptionHcp protein
UniProt IDG8MD59
KEGG IDbyi:BYI23_B001010
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.30E-38, Aligned region: 13..143
Protein Sequence: 158 a.a.     [Download]
>gi|377812346|ref|YP_005041595.1| hcp protein [Burkholderia sp. YI23]
MCRPVLWDCVSFVEGSNKVQGHEGKILVQAVDHTIEIPKSPQTGLPTGKRVHGAMTITKEIDKSSPKLFQ
ALTSGEQMKDVSLEFYRVSPKGTEEKYYTVKLSNAILTNMKSWTPNALDPNNKQIGHMEDLAFTYEKISW
TYEPDGIEAEDSWLAPKA
-
Nucleotide Sequence: 477 bp     [Download]
>gi|377812245|ref|NC_016625.1|:c128921-128445 Burkholderia sp. YI23 chromosome 2, complete sequence
ATCTGCCGGCCGGTGCTTTGGGATTGTGTTTCATTCGTAGAAGGCTCGAACAAAGTCCAAGGTCACGAAG
GAAAGATTCTCGTACAGGCCGTCGATCACACCATCGAAATCCCGAAGAGCCCGCAAACGGGTTTGCCTAC
CGGCAAGCGCGTGCATGGGGCGATGACGATTACCAAGGAAATCGACAAGTCCTCGCCCAAGCTGTTTCAG
GCGCTGACCTCGGGCGAGCAGATGAAGGACGTGTCGCTGGAGTTCTACCGCGTCTCGCCGAAGGGCACGG
AAGAGAAGTACTACACCGTGAAACTGTCGAATGCGATTCTGACGAATATGAAGTCGTGGACGCCGAATGC
GCTGGATCCGAACAACAAGCAAATTGGCCACATGGAAGACCTCGCGTTCACGTACGAGAAGATCAGCTGG
ACATACGAACCGGACGGTATCGAAGCCGAAGATTCGTGGCTTGCGCCGAAGGCTTGA
 Primer design