SecReT6
Effector Protein ID: 377820810
SecReT6 ID516
T6SS typeA1
Gene symbol-
Locus tagBYI23_A013660
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016589] [Browse all T6SS(s) in this replicon]
Location [Strand]1538228..1538716 [+]
Producthcp protein
Effector typeProtein
Homologous effectorBTH_II0868
DescriptionHcp protein
UniProt IDG8MA79
KEGG IDbyi:BYI23_A013660
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.00E-39, Aligned region: 6..146
Protein Sequence: 162 a.a.     [Download]
>gi|377820810|ref|YP_004977181.1| hcp protein [Burkholderia sp. YI23]
MPMPCYLTLEGQNQGKIEGSIKVTGHEGKILVQAVDHTIEIPKSPQTGLPTGKRVHLPMTLTKEIDKSSP
KLYQALTSGEQMKVVTLEFYRISPKGTEEKYYTVQLSNAILTNMKSWTPNALDPENRQMGHMEDVSFTYE
KITWTFDPDGIEAEDSWLAPKS
-
Nucleotide Sequence: 489 bp     [Download]
>gi|377819444|ref|NC_016589.1|:1538228-1538716 Burkholderia sp. YI23 chromosome 1, complete sequence
ATGCCGATGCCTTGCTACCTCACGCTCGAAGGACAGAACCAGGGGAAAATCGAAGGCTCCATCAAGGTGA
CGGGCCACGAAGGAAAGATCCTCGTGCAGGCTGTGGATCACACCATCGAGATTCCGAAGAGCCCGCAAAC
GGGGCTGCCCACCGGCAAGCGTGTGCATTTGCCGATGACGCTGACGAAGGAAATCGACAAGTCGTCGCCG
AAGCTTTATCAGGCATTGACGTCGGGCGAGCAGATGAAGGTTGTGACGCTGGAGTTTTATCGCATCTCGC
CGAAGGGCACGGAGGAGAAGTACTACACCGTTCAGCTGTCGAATGCGATTCTGACGAACATGAAGTCGTG
GACGCCCAATGCGCTCGATCCGGAGAACCGCCAGATGGGGCATATGGAAGATGTGTCGTTCACGTACGAG
AAGATCACGTGGACTTTCGACCCGGACGGCATCGAAGCTGAAGATTCCTGGTTGGCGCCGAAGTCTTGA
 Primer design