SecReT6
Effector Protein ID: 378949895
SecReT6 ID539
T6SS typeA4a
Gene symbolhcp2
Locus tagPSF113_1976
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]2318202..2318702 [-]
Productprotein Hcp2
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDG8Q6B4
KEGG IDpfe:PSF113_1976
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.30E-40, Aligned region: 22..150
Protein Sequence: 166 a.a.     [Download]
>gi|378949895|ref|YP_005207383.1| protein Hcp2 [Pseudomonas fluorescens F113]
MTITDNNQILLTEKAFSADSVGNIYQEGHKDEIMVQGFQHQVTIPRDPQSGQPTGQRIHQPLVITKVFDR
ASPLLQQVLCSGEVLTKVEIKWYRTSAAGTQEHYYTTTLEDAIIVEIKDYMLNCQDPANTHFTHLEDVHF
TYRKITWTHEISNTTGSDDWRSPVVG
-
Nucleotide Sequence: 501 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c2318702-2318202 Pseudomonas fluorescens F113 chromosome, complete genome
ATGACCATTACAGACAACAATCAAATATTGCTGACCGAGAAGGCGTTTTCCGCCGACTCGGTGGGTAACA
TTTATCAGGAAGGCCATAAAGACGAAATCATGGTGCAAGGTTTCCAGCATCAGGTGACCATCCCACGAGA
CCCCCAGTCCGGTCAGCCAACCGGTCAACGCATACACCAACCCTTGGTCATCACCAAAGTCTTTGACAGA
GCCTCACCGCTGCTGCAGCAAGTCCTGTGCAGTGGCGAAGTCCTGACCAAAGTTGAAATCAAGTGGTACC
GCACTTCGGCGGCCGGTACTCAAGAGCACTACTACACCACCACACTGGAGGACGCGATCATCGTCGAGAT
CAAGGACTACATGCTCAACTGCCAAGACCCGGCGAACACGCATTTCACCCATTTGGAAGACGTACACTTC
ACCTATCGCAAGATCACTTGGACCCACGAAATCAGCAATACCACGGGTTCCGATGACTGGCGTTCGCCCG
TTGTCGGTTGA
 Primer design