SecReT6
Effector Protein ID: 378950796
SecReT6 ID539
T6SS typeA4a
Gene symbolvgrG1b
Locus tagPSF113_2885
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]3396141..3398366 [+]
Productprotein VgrG1b
Effector typeProtein
Homologous effectorPA0095
Descriptiontype VI secretion system Vgr family protein
UniProt IDG8Q200
KEGG IDpfe:PSF113_2885
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.30E-88, Aligned region: 30..329
Phage_base_V [PF04717], Evalue: 2.60E-26, Aligned region: 369..461
Gp5_C [PF06715], Evalue: 7.80E-24, Aligned region: 5..13
Gp5_C [PF06715], Evalue: 7.80E-24, Aligned region: 514..533
Gp5_C [PF06715], Evalue: 7.80E-24, Aligned region: 530..552
Gp5_C [PF06715], Evalue: 7.80E-24, Aligned region: 554..576
Gp5_C [PF06715], Evalue: 7.80E-24, Aligned region: 578..600
Gp5_C [PF06715], Evalue: 7.80E-24, Aligned region: 594..615
Gp5_C [PF06715], Evalue: 7.80E-24, Aligned region: 601..624
Gp5_C [PF06715], Evalue: 7.80E-24, Aligned region: 610..631
Gp5_C [PF06715], Evalue: 7.80E-24, Aligned region: 625..643
Gp5_C [PF06715], Evalue: 7.80E-24, Aligned region: 633..656
Gp5_C [PF06715], Evalue: 7.80E-24, Aligned region: 649..671
Gp5_C [PF06715], Evalue: 7.80E-24, Aligned region: 658..675
Gp5_C [PF06715], Evalue: 7.80E-24, Aligned region: 697..714
DUF2345 [PF10106], Evalue: 0.00076, Aligned region: 578..616
DUF2345 [PF10106], Evalue: 0.00076, Aligned region: 639..736
Protein Sequence: 741 a.a.     [Download]
>gi|378950796|ref|YP_005208284.1| protein VgrG1b [Pseudomonas fluorescens F113]
MAITQNNRLVQVDSPLGGDVLLLQSMEGSEELGRLFHYELDLTSEDRAITFDQLLGKPMGLTLELYDGGK
RYFHGIVCSCRQLTGHGQFAGYRVSLRPWFWLLTRTSDCRIFQNKTVPDIIKQVFRDLGFSDFEDSLSGS
YREWEYCVQYRETSFDFVSRLMEQEGIYYYFRHEEARHVLVLADAYGAHTTAPDYASVPFYPPDRQMRER
DHFYDWQLAREVQPGSLALNDYDFLRPRASLEVRSSVPRNHTNADYPLYDYPGEYVQSNDGDHYARTRIE
AIHSQFERVQLRGRARGIGCGHVFTLTGYDRADQNREYLVVAARYQIRQDAYESGQFDVDEQFVSELDCM
DASQVFRPLPLTPMPIVRGPQTAVVVGPSGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSVQLPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYGLPANATQSGVKSRSSKGGSPANFNEIRM
EDKKGSEQLFIHAEKNQDIEVENDETHWVGHDRRKTIDNDETVHVKHDRTETVDNNETITIGVDRKEKVG
NNETISIGVNRTEDVGSNEKITIGANRTENVGSNETITIGADRTEKVGANEKITIVSNRTEDVGGNETIG
ITGNRNETVQGNEGIEISGNQSTQIGQNESRDVAQNRTTNIKQNDSLDVGKHFSLTAGDSISLTTGDASI
TMKKDGTIMISGKNITIDGSGAIKIKASKNVVVKGQKILQN
-
Nucleotide Sequence: 2226 bp     [Download]
>gi|378947941|ref|NC_016830.1|:3396141-3398366 Pseudomonas fluorescens F113 chromosome, complete genome
ATGGCAATCACGCAAAACAACCGTTTGGTGCAGGTCGACAGTCCTCTCGGCGGCGATGTCCTGTTGTTGC
AAAGCATGGAAGGCAGCGAAGAGCTGGGGCGGTTGTTTCACTACGAATTGGACCTGACCTCCGAAGACCG
GGCAATCACGTTCGACCAGTTGCTGGGCAAGCCGATGGGCCTGACCCTGGAGCTGTACGACGGTGGCAAA
CGCTACTTCCACGGCATTGTCTGCAGTTGTCGGCAACTGACCGGGCACGGCCAGTTCGCCGGTTATCGCG
TCAGTCTACGGCCCTGGTTCTGGCTGCTTACGCGCACCTCCGACTGCCGGATTTTCCAGAACAAGACCGT
GCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGTTTCTCCGATTTCGAGGACAGCCTGAGCGGCAGC
TACCGCGAGTGGGAATATTGCGTGCAGTACCGCGAAACCAGCTTCGATTTCGTCAGCCGGTTGATGGAGC
AGGAAGGCATCTATTACTACTTTCGCCATGAAGAGGCGCGTCATGTGTTGGTGTTGGCCGACGCCTATGG
CGCCCACACCACGGCACCCGACTATGCCTCGGTGCCCTTCTATCCGCCTGATCGGCAAATGCGCGAGCGC
GATCATTTCTACGACTGGCAACTGGCGCGGGAAGTCCAACCCGGCTCGCTGGCGCTGAACGACTATGACT
TCCTGCGCCCGCGCGCCAGTCTTGAGGTGCGCTCCAGCGTGCCGCGAAACCACACCAACGCCGACTACCC
GCTCTACGACTACCCGGGTGAATACGTCCAGAGCAACGATGGCGATCACTACGCGCGGACCCGCATCGAG
GCCATTCACAGCCAGTTCGAGCGTGTGCAATTACGCGGCCGCGCCCGCGGCATCGGTTGCGGTCATGTGT
TCACGCTGACGGGGTACGACCGTGCTGACCAGAACCGCGAGTATCTCGTGGTGGCCGCCCGTTATCAGAT
TCGTCAGGATGCCTATGAAAGCGGCCAGTTTGACGTCGACGAACAGTTCGTCAGCGAGCTGGACTGCATG
GATGCCAGCCAAGTCTTCCGCCCTCTGCCCCTCACGCCCATGCCCATTGTTCGCGGGCCGCAGACTGCCG
TGGTGGTCGGCCCCAGTGGCGAGGAGATCTGGACCGACCAATATGGCCGGGTCAAAGTGCATTTCCACTG
GGATCGCCATGACCAGTCCAACGAAAACAGCTCCTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGCAAG
AACTGGGGATCCGTACAGCTCCCGCGGATCGGTCAGGAAGTGATCGTCAGTTTCCTCGAGGGCGATCCGG
ATCGGCCGATTATCACTGGCCGCGTCTACAACGCTGAACAGACCGTGCCCTACGGATTGCCGGCCAATGC
CACCCAGAGCGGGGTGAAAAGCCGTTCAAGCAAGGGCGGTTCACCGGCCAACTTCAATGAAATCCGCATG
GAGGACAAGAAAGGCTCCGAGCAGCTGTTTATCCACGCCGAAAAAAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGGTGGGCCACGACCGCCGCAAGACCATCGACAACGACGAGACCGTACACGTCAAACA
TGACCGCACCGAAACCGTCGACAACAACGAAACCATCACCATCGGTGTGGATCGCAAGGAAAAGGTCGGC
AATAACGAAACCATCTCCATCGGTGTGAACCGCACCGAGGATGTTGGCAGCAACGAGAAAATCACCATTG
GCGCCAATCGCACCGAGAACGTGGGCAGTAACGAGACCATCACCATCGGCGCAGACCGCACGGAAAAGGT
CGGTGCCAACGAAAAAATCACCATCGTCAGCAACCGTACCGAGGACGTGGGCGGCAACGAGACCATCGGC
ATCACCGGCAACCGTAACGAAACGGTCCAGGGCAACGAAGGCATCGAGATCAGCGGTAACCAGAGCACCC
AGATCGGCCAGAACGAATCCCGCGACGTCGCCCAGAACCGCACCACCAACATCAAGCAGAACGACAGCCT
GGACGTTGGCAAGCACTTCTCCCTTACCGCCGGCGACTCCATCAGCCTGACGACGGGTGACGCCAGCATC
ACCATGAAGAAGGACGGCACGATCATGATCAGCGGCAAGAACATCACCATCGACGGCTCCGGCGCCATCA
AGATCAAGGCCAGCAAGAATGTGGTCGTCAAAGGCCAGAAAATTCTGCAGAACTAG
 Primer design