SecReT6
Effector Protein ID: 379743473
SecReT6 ID557
T6SS typeA1
Gene symbol-
Locus tagO3Y_13573
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]19780..20298 [+]
Producthcp protein
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDH8JY21
KEGG IDvci:O3Y_06560, vci:O3Y_13573
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.30E-38, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|379743473|ref|YP_005334525.1| hcp protein [Vibrio cholerae IEC224]
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQ
NVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|379743460|ref|NC_016945.1|:19780-20298 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGCCAACTCCATGTTATATCTCTATCGAAGGCCAAACTCAGGGTCTTATCACTGCAGGCGCATGTACTG
CTGACTCTATCGGCGATTCATTCGTTGAAGGCCATGAAGATGAGATGCTGGTTCAGCAGTTTGACCACGT
CGTAACCGTACCGACTGACCCACAATCTGGTCAGCCTTCCGGCCAACGTGTGCACAAGCCATTCAAATTC
ACTGTGGCGCTGAACAAAGCGGTTCCTCTGCTGTACAACGCGCTCTCTTCAGGTGAGAAGCTGAAAACCG
TTGAGCTGAAATGGTACCGTACTTCTATCGAAGGCAAACAAGAAAACTTCTTCACCACTAAGCTGGAAAA
CGCGTCTATCGTTGATATCCACTGTGAAATGCCACACTGCCAAGACCCAGCAAAATCTGACTTTACTCAG
AATGTGACTGTGTCTCTGTCTTACCGCAAAATCACTTGGGACCACGTTAACGCGGGCACCTCAGGCTCTG
ATGACTGGCGTAAGCCAATCGAAGCGTAA
 Primer design