SecReT6
Effector Protein ID: 379743474
SecReT6 ID557
T6SS typeA1
Gene symbol-
Locus tagO3Y_13578
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]20426..22510 [+]
Producttype VI secretion system secreted protein VgrG
Effector typeProtein
Homologous effectorVCA0018
Descriptiontype VI secretion system Vgr family protein
UniProt IDH8K017
KEGG IDvci:O3Y_13578
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-64, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 3.30E-24, Aligned region: 208..227
Phage_base_V [PF04717], Evalue: 3.30E-24, Aligned region: 374..467
Phage_Mu_Gp45 [PF06890], Evalue: 0.00087, Aligned region: 426..452
Phage_Mu_Gp45 [PF06890], Evalue: 0.00087, Aligned region: 569..618
DUF2345 [PF10106], Evalue: 0.0018, Aligned region: 575..617
Protein Sequence: 694 a.a.     [Download]
>gi|379743474|ref|YP_005334526.1| type VI secretion system secreted protein VgrG [Vibrio cholerae IEC224]
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYQMQLASRVSNLTADQMVDKRAELKLY
RNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGIHDYA
FALKRDCVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALAGG
TMDTPYIHGLTYRTQAEVSEVQLKDYSFKKPAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFS
QIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEEGGSGATTYN
NQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQ
GWAGSQYGFIAIPRIGHEVIVSFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTETHQGEGFNEL
SFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDQHLTVENDQFTQIKHNQHLTVEGESRTLVKLDCSSE
IGGSLQQKIGSKAIYDAGTEVHLKAGNKLVLEAGNELTIKAGGSFIKVDAGGVHVVGSAINLNSGGSAGS
GSGYGGKMAELPQGVDKAKTPQEIELAAVTPTQQSMSPLLKARQIEALKGPAPVCEVCEEAKGN
-
Nucleotide Sequence: 2085 bp     [Download]
>gi|379743460|ref|NC_016945.1|:20426-22510 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGGCGACATTAGCGTACAGCATTGAGGTGGAAGGGCTGGAAGATGAGACTCTGGTGGTCAGAGGCTTTC
ACGGGCAGGAGTCACTCTCCAACAGTGTTTTTTTAGGGCAAGCCTGTTACGGGTTTCGCTATCAAATGCA
ACTGGCGAGTCGGGTATCCAATCTGACTGCCGACCAGATGGTCGATAAGCGTGCTGAGCTCAAGCTTTAC
CGCAACTCACAATTGGTGCAGCGTGTGCACGGCATTGTACGTGCCTTTAGCCAAGGCGATATCGGCCATC
ACCACACCTTCTACCAACTCACTTTAGTGCCTGCCTTAGAGCGCTTATCCCTGCGCCACAATAGCCGCAT
TTTCCAAAAGCAGACTGTTCCAGAAATTCTCTCTATCTTGCTGCAAGAGATGGGCATCCACGATTACGCT
TTTGCGCTCAAACGTGATTGCGTGCAGCGTGAGTTTTGTGTGCAGTACCGTGAAAGTGATATCGACTTTC
TGCACCGCCTCGCCGCTGAAGAAGGCTTGGTGTACAGCTTTGTCCATGAAGCGGGCAAACATACCCTCTA
TTTCAGTGATGCCAGTGACAGCCTAAGTAAACTGCCGGAGCCCATCCCGTACAACGCCTTAGCGGGCGGC
ACGATGGATACACCGTACATCCACGGCTTAACCTATCGCACCCAAGCGGAAGTGAGCGAAGTTCAGCTCA
AAGATTACAGCTTCAAAAAGCCGGCGTACTCGTTTTTACAAACCGTGCAGGGTACTGAGCTGGATTATCA
GCAAACGCGCTACCAACATTTTGATGCGCCGGGGCGCTACAAAGACGATGTGAACGGCGCCGCCTTTAGC
CAAATCCGTTTAGACTACCTGCGCCGCCATGCCCACACCGCAACAGGGCAGAGCAACGAGCCGCTGCTGC
GTGCCGGCTATAAGTTTGACCTGCAAGAGCATCTTGACCCTGCGATGAACCGCGATTGGGTGGTGGTCTC
TATTAACCATCAAGGTGAGCAGCCGCAAGCGTTACAAGAAGAGGGCGGCAGTGGTGCAACGACCTACAAC
AACCAGTTCAGCTTAATTCCAGGGCATCTCCACTGGCGCGCCGAGCCACAACCCAAACCGCAAGTCGATG
GTCCAATGATAGCCACGGTCGTCGGTCCTGAAGGCGAAGAAATCTTCTGTGATGAACACGGGCGGGTGAA
AATCCATTTTCCGTGGGACCGCTACTCGAACGGTAACGAGCAAAGCTCCTGTTGGGTACGGGTGTCGCAA
GGTTGGGCGGGCAGTCAGTATGGCTTTATCGCTATTCCGCGCATCGGTCATGAAGTGATTGTTTCTTTCT
TAAATGGCGACCCAGACCAACCGATTATCACTGGCCGCACCTATCATGCGACCAATACGCCGCCATACAC
TTTGCCAGAGCACAAAACCAAAACCGTGCTGCGCACCGAGACGCACCAAGGGGAAGGGTTTAACGAGCTC
AGTTTTGAAGACCAAGCGGGCAAAGAGCAAATCTACCTGCATGCGCAGAAAGACTTCGATGGTTTGATTG
AAAACGACCACACCACGGTCATTCGCCACGACCAACACCTGACCGTTGAAAACGACCAGTTCACTCAGAT
TAAGCACAACCAACACCTGACGGTCGAGGGGGAGAGTCGTACGCTCGTCAAACTCGACTGCAGCAGCGAA
ATCGGCGGTTCATTGCAGCAAAAAATCGGCAGCAAAGCGATTTACGATGCAGGCACAGAGGTTCACCTTA
AAGCGGGTAACAAACTGGTCTTGGAAGCAGGCAACGAGCTTACCATCAAAGCCGGCGGCAGTTTTATTAA
AGTCGATGCTGGCGGTGTGCACGTCGTCGGCTCTGCTATTAACCTCAACTCCGGCGGCAGCGCAGGCAGC
GGCTCAGGCTATGGCGGTAAAATGGCCGAGTTGCCACAAGGGGTGGATAAAGCCAAAACGCCGCAAGAGA
TTGAGCTAGCCGCGGTAACTCCCACTCAGCAGTCTATGTCGCCTTTACTTAAGGCGCGACAAATTGAAGC
ACTCAAAGGTCCTGCACCTGTGTGTGAAGTGTGTGAAGAGGCCAAGGGAAATTAA
 Primer design