SecReT6
Effector Protein ID: 379743476
SecReT6 ID557
T6SS typeA1
Gene symbol-
Locus tagO3Y_13588
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]23394..26651 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0020
DescriptionVasX protein
UniProt IDH8K019
KEGG IDvci:O3Y_13588
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1085 a.a.     [Download]
>gi|379743476|ref|YP_005334528.1| hypothetical protein O3Y_13588 [Vibrio cholerae IEC224]
MSNPNQAAKTGQTNDAQNPASACPFKQPLIGIIPVRYAFDVYDDQGQALHPLPKADRQWKGQFSIKQRSY
TLRQLRDGWLYVYDETAKTLHEYEVVGCKLTKIDWSDDEANKPTHERGSKGESKSCLLYPAQHTLSIGYA
HQRWTWRVCEHMRSNTSSRHAVMRKVSLKQFESNGTHPHAHFAQYLEDYVADIGTPAEQDIFKDTCTPSL
PVEKSEEAVKGTEFKFVADKAVVSSSDYLQDLPEQNCGLFVALNDPLADVSDLFVTFTTQVAKRTKAIGD
ETQQHKMQMAELTRTLGRIRLEEKEIPDFVKQDPIRILELERAITEYCATAKLAEIESHHLASEGHSPSG
NYALMQQQAEQKLAELKTLYRFEPTSAQMRKWRKKDNSFIDEVRWADLDNFLVEHYTELKGLDEQIKQHY
AQFMSAFNQLGLDPLLFGMDNQDEVQQAYLLALTSQFLVVVTQVNHDEKSLEILKKDLSFDSPKNLMALA
STGFSLQANQAINNHIQGFSTAFLSTSNPSDMVAFATAIANWDTFTGDERIQEKAWFKRWIEPVQSSFGA
LQKAVANQAKESWQAVMELLFPYQNQPKGGTPSLLANLRLLLVESLVREEAVLQHNPKYAAELKQFETKL
NAILQEMNDALELKPGNVSPKNHQIATAQSAQRKLGQLLSSELPMMLTLKNQAAMNTFQQSVNEKLSALS
KNVKTSSASVSQKLGGLGGLLFALNLWNTMTVLENIRYKVAQYPSWNPFKNPALGEAIYATGNTIVVAGA
ISAGRAWVTIAEQGLLDRTLKNALNTTKVLGTKDALKTFAKSIALVATVGMIASALETWESWGKFNDSSK
TDLERFGYLLKAGATGAQGIIFYIQFFTLLGSGIGGPSIAAISAGWMLAGFAVIGIVYLIGVILTNVFKR
SELEIWLSKSTWGKESAHWPVGKELTELEHLLHRPSLRLSQVTQRKAAQWMDSGSLQWQLELTLPDYLKG
QTIGLQITRLPAQPAYYQPQREAVTPILINEQQGKWSIEDNQPVYRITLGGSEKDTVGVCVALPLRWGKE
LSLKFYASGTRAGELDLQSAEANDIATRNLVVGKG
-
Nucleotide Sequence: 3258 bp     [Download]
>gi|379743460|ref|NC_016945.1|:23394-26651 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGAGTAATCCCAATCAAGCTGCGAAAACAGGACAGACCAATGATGCGCAAAATCCCGCCAGTGCATGTC
CTTTTAAACAGCCGTTAATAGGGATAATTCCTGTTCGTTACGCCTTTGATGTTTATGATGATCAAGGTCA
AGCATTACATCCTTTACCCAAAGCGGATCGACAGTGGAAAGGTCAATTCTCTATCAAGCAGCGCAGTTAC
ACTTTAAGGCAACTGCGTGATGGCTGGCTCTATGTCTATGATGAAACAGCAAAAACACTGCACGAATATG
AAGTCGTTGGCTGCAAGTTGACCAAAATTGATTGGTCTGATGATGAGGCAAACAAACCCACTCACGAGCG
CGGTTCGAAAGGTGAAAGCAAAAGCTGTTTACTCTATCCCGCCCAGCACACGCTCTCTATCGGTTATGCG
CATCAACGATGGACGTGGCGAGTGTGTGAGCATATGCGCTCCAATACCAGCAGCCGTCATGCTGTGATGC
GTAAAGTGAGCCTTAAACAGTTTGAGTCCAATGGTACTCACCCTCATGCACATTTTGCTCAGTATCTTGA
AGACTATGTGGCGGACATCGGGACGCCAGCTGAGCAGGATATTTTTAAAGATACCTGTACCCCTTCATTA
CCGGTAGAGAAAAGTGAAGAAGCGGTGAAAGGTACGGAATTCAAATTCGTTGCCGACAAAGCGGTGGTAA
GCAGCAGTGATTATTTGCAAGATTTGCCGGAGCAAAACTGCGGTTTATTTGTGGCGCTGAATGACCCTTT
AGCGGATGTGTCAGATTTATTTGTTACTTTTACTACCCAAGTGGCAAAGCGAACTAAAGCGATTGGTGAT
GAAACGCAACAGCATAAAATGCAGATGGCAGAGCTGACACGCACATTAGGCCGAATTCGTCTTGAAGAAA
AAGAAATTCCCGATTTTGTAAAACAAGATCCGATCCGTATTTTAGAGCTAGAAAGAGCCATTACTGAATA
TTGTGCTACGGCAAAATTGGCCGAAATCGAATCTCATCATTTAGCCAGTGAAGGGCATTCCCCATCGGGA
AACTATGCCTTGATGCAGCAGCAAGCGGAGCAGAAACTGGCGGAATTGAAAACACTCTATCGCTTTGAAC
CCACCAGTGCTCAGATGCGCAAGTGGCGCAAAAAAGACAACAGCTTTATTGATGAAGTGCGTTGGGCGGA
TTTAGATAACTTTTTGGTGGAGCATTACACCGAGCTCAAAGGATTGGATGAACAGATTAAACAACACTAT
GCGCAGTTTATGTCTGCCTTCAACCAGCTCGGCCTTGACCCGCTTCTGTTTGGTATGGATAACCAAGATG
AGGTTCAGCAAGCGTATTTGTTAGCATTAACTAGCCAATTTTTAGTGGTGGTTACGCAAGTCAATCATGA
TGAAAAATCGCTTGAGATCCTAAAAAAAGATCTCAGTTTTGATTCACCGAAAAACCTCATGGCCCTCGCG
TCAACAGGCTTTTCCCTGCAGGCAAATCAAGCCATTAACAACCATATCCAAGGGTTTAGCACCGCTTTTC
TCTCTACAAGTAATCCTAGTGATATGGTGGCGTTTGCGACCGCAATCGCTAACTGGGATACGTTCACGGG
GGATGAACGTATTCAGGAGAAAGCATGGTTTAAGAGATGGATTGAACCCGTTCAATCGAGTTTTGGTGCA
CTGCAAAAAGCGGTCGCCAATCAAGCCAAAGAGAGTTGGCAAGCGGTGATGGAGTTGCTGTTTCCTTATC
AGAATCAGCCCAAAGGAGGGACGCCCAGTTTGTTGGCTAACCTTCGTTTACTGTTGGTGGAAAGCCTAGT
TCGAGAAGAGGCGGTGCTGCAACATAACCCCAAGTATGCGGCTGAGCTTAAGCAATTTGAGACTAAGCTG
AATGCCATTTTGCAAGAGATGAATGATGCTCTGGAACTCAAACCCGGTAATGTGAGCCCGAAAAACCATC
AAATTGCGACCGCGCAATCCGCACAACGTAAGCTAGGGCAATTACTCAGTAGTGAGCTGCCGATGATGCT
GACGCTCAAAAACCAAGCTGCGATGAACACTTTTCAGCAGTCGGTAAATGAGAAACTGAGCGCGCTATCG
AAAAACGTCAAAACCAGTAGCGCGTCGGTGAGTCAGAAACTGGGTGGATTAGGGGGCTTGCTGTTTGCGT
TGAACCTATGGAATACCATGACGGTTTTGGAGAATATCCGCTATAAGGTCGCACAATACCCCAGTTGGAA
TCCTTTTAAGAACCCGGCGTTGGGCGAAGCCATTTATGCCACTGGCAACACTATTGTAGTCGCCGGTGCC
ATTAGTGCTGGGCGAGCTTGGGTGACGATTGCTGAGCAAGGGTTGTTAGATCGTACACTGAAAAACGCCT
TAAATACCACGAAAGTTTTGGGCACAAAAGATGCCCTAAAAACCTTTGCTAAATCGATCGCCTTGGTGGC
TACCGTGGGCATGATTGCCAGCGCATTAGAAACATGGGAAAGCTGGGGTAAGTTTAATGACAGCAGTAAA
ACCGATCTTGAACGCTTCGGTTATTTGTTAAAAGCTGGAGCAACGGGAGCACAGGGAATTATTTTTTATA
TTCAGTTTTTCACACTCTTAGGTAGTGGAATTGGTGGACCCTCCATAGCTGCGATTTCTGCAGGTTGGAT
GCTCGCCGGTTTTGCTGTGATTGGTATTGTCTATTTGATCGGGGTGATTTTGACCAATGTGTTTAAACGC
TCAGAGTTAGAAATTTGGTTATCAAAATCGACGTGGGGGAAAGAGAGTGCTCATTGGCCAGTGGGCAAAG
AATTGACCGAGTTAGAGCACCTTCTCCATCGTCCGAGTCTTCGGTTGAGTCAAGTTACGCAACGTAAAGC
AGCGCAATGGATGGATTCAGGTTCTTTACAATGGCAGTTGGAACTCACGTTACCCGATTATCTTAAGGGG
CAGACGATAGGCTTACAAATCACCCGTTTGCCAGCGCAGCCGGCATATTATCAACCGCAAAGGGAGGCGG
TAACACCAATACTCATCAATGAACAACAGGGCAAATGGAGTATTGAAGATAATCAGCCAGTGTATCGTAT
TACACTGGGTGGCAGTGAGAAGGATACTGTCGGAGTTTGCGTTGCACTGCCCCTGCGTTGGGGCAAGGAG
CTGAGCCTCAAATTCTATGCCAGTGGAACTCGCGCGGGGGAATTGGATTTACAATCTGCAGAGGCGAATG
ATATTGCCACAAGAAATCTCGTTGTAGGAAAAGGTTAA
 Primer design