SecReT6
Effector Protein ID: 379743715
SecReT6 ID557
T6SS typeA1
Gene symbol-
Locus tagO3Y_14793
StrainVibrio cholerae IEC224
Repliconchromosome II [GenBank: NC_016945] [Browse all T6SS(s) in this replicon]
Location [Strand]305167..305838 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0285
DescriptionTseH
UniProt IDH8JZZ8
KEGG IDvci:O3Y_14793
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 223 a.a.     [Download]
>gi|379743715|ref|YP_005334767.1| hypothetical protein O3Y_14793 [Vibrio cholerae IEC224]
MTDTVSSTPVADTTPYEIFLSGNDDFLIPVVFPDYLISVADEQSFELWGVKIKTPAVKAPYLGHAGVILI
NGETGVTRYYEYGRYKNPKSDIPGNVRKVGVSNVTIKSGLITESSLLKVLKEVSLRSGQEGRISGVVLRG
KFFSEADSWLRGKMDLNNSPDKIPYDLDSHNCMTFVIDLADAMGLDPAWKPPVVVPSAYIEQFQLSEIDL
DYDYKTNKLTVSE
-
Nucleotide Sequence: 672 bp     [Download]
>gi|379743460|ref|NC_016945.1|:305167-305838 Vibrio cholerae IEC224 chromosome II, complete sequence
ATGACTGACACTGTATCATCAACTCCAGTAGCCGATACAACTCCATATGAGATATTTCTTTCAGGTAATG
ACGATTTTTTGATACCTGTAGTATTTCCTGACTACCTAATCTCAGTCGCAGATGAACAATCTTTTGAGTT
ATGGGGTGTAAAAATAAAAACTCCTGCAGTGAAGGCCCCCTACCTTGGTCACGCTGGAGTTATTTTGATT
AATGGTGAAACAGGTGTTACTCGCTATTATGAGTATGGCCGTTACAAGAACCCTAAATCGGATATCCCAG
GAAATGTGAGGAAGGTTGGGGTATCAAATGTAACTATAAAAAGTGGTCTAATTACTGAAAGCTCGTTACT
GAAGGTTCTTAAAGAAGTGTCCCTACGTTCTGGACAGGAGGGGAGAATTTCGGGAGTGGTATTAAGAGGA
AAGTTTTTCTCTGAAGCAGATTCATGGTTAAGGGGAAAAATGGATCTTAATAATAGCCCTGATAAGATAC
CTTATGACTTGGATAGCCATAACTGCATGACATTTGTCATAGATTTAGCTGATGCAATGGGGTTAGACCC
GGCTTGGAAACCTCCTGTTGTTGTACCAAGCGCGTATATTGAACAGTTTCAGTTAAGTGAAATTGATTTA
GATTATGACTATAAGACCAACAAATTAACGGTATCTGAGTGA
 Primer design