SecReT6
Effector Protein ID: 384414009
SecReT6 ID590
T6SS typeA3
Gene symbol-
Locus tagYPC_1461
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]1435432..1435917 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorROD_27741
DescriptionHcp protein
UniProt IDE8P3W3
KEGG IDyph:YPC_1461
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.40E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|384414009|ref|YP_005623371.1| hypothetical protein YPC_1461 [Yersinia pestis biovar Medievalis str. Harbin 35]
MAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHSGSGGGSGKASVSDFCFAHYIDKASPNLL
SYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETRPREEIRFSFTKMTQDYVMQN
AEGHKSGVISANYDVKANMHS
-
Nucleotide Sequence: 486 bp     [Download]
>gi|384412706|ref|NC_017265.1|:1435432-1435917 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGGCGCAAGATATGTTTATCAAAATTGATGGTATTGAAGGTGAGTCTTTGGATGCCAATCACAAAAACG
AAATCCAGGTATTAGCTTGGAACTGGGATGTTGCTCAACACTCGAATATGCACAGCGGTTCAGGTGGCGG
TTCAGGTAAAGCCTCTGTTTCAGATTTTTGCTTCGCACATTATATCGATAAAGCTAGCCCGAACTTATTG
AGCTATTGCTTGTTGGGTAAGCACATTAAAAATGTTCAGTTCGTACTGCGTAAAGCTGGTGGCGATCCGC
TGGAATATCTGACAATTAAATTTACCGATGTCATCATTACTCGTGTTGATATGGCGGGTTCTTTGGAAGA
TGAAACGCGTCCACGTGAAGAAATTCGTTTCTCATTCACTAAGATGACTCAGGACTATGTTATGCAGAAT
GCTGAAGGCCATAAGTCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACATGCACAGCTAA
 Primer design