SecReT6
Effector Protein ID: 386592184
SecReT6 ID621
T6SS typeA3
Gene symbol-
Locus tagSU5_02970
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. B182
Repliconchromosome [GenBank: NC_017623] [Browse all T6SS(s) in this replicon]
Location [Strand]3219782..3220150 [+]
ProductNlpC/P60 enzyme
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDI0ABF3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NLPC_P60 [PF00877], Evalue: 9.10E-05, Aligned region: 23..95
CHAP [PF05257], Evalue: 0.0001, Aligned region: 17..88
Protein Sequence: 122 a.a.     [Download]
>gi|386592184|ref|YP_006088584.1| NlpC/P60 enzyme [Salmonella enterica subsp. enterica serovar Heidelberg str. B182]
MSWDKRVAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHAKDYGPMLRSAGFTAIGTYEMPREGD
VIIIQPYAGGNPSGHMAIYDGTEWYSDFKQRDMWAGPGYRAARPSYTIYRKN
-
Nucleotide Sequence: 369 bp     [Download]
>gi|386589256|ref|NC_017623.1|:3219782-3220150 Salmonella enterica subsp. enterica serovar Heidelberg str. B182 chromosome, complete genome
ATGAGTTGGGATAAAAGAGTGGCGGTTAATTATGCCAAAACGCATGCAGGTTCTCATTCTCAAGGCCGGT
GTGCGGAATTTACCCGAAAGGCAATTCAGGCGGGCGGTATCACGCTGGGGCATACATATCATGCGAAAGA
TTATGGCCCAATGTTAAGAAGCGCCGGATTCACCGCTATTGGTACCTATGAAATGCCGCGCGAGGGTGAC
GTCATTATTATTCAACCTTACGCTGGCGGAAACCCGAGCGGTCACATGGCGATATACGATGGCACAGAGT
GGTATTCAGATTTTAAACAACGCGATATGTGGGCCGGCCCGGGCTACCGGGCAGCCAGGCCCTCATATAC
CATCTACAGGAAGAATTAA
 Primer design