SecReT6
Effector Protein ID: 387618086
SecReT6 ID628
T6SS typeA2
Gene symbol-
Locus tagNRG857_13810
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]2906468..2906959 [+]
Producthemolysin-coregulated protein Hcp
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDE4P5G8
KEGG IDeln:NRG857_13810
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|387618086|ref|YP_006121108.1| hemolysin-coregulated protein Hcp [Escherichia coli O83:H1 str. NRG 857C]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHDIKDPSREKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|387615344|ref|NC_017634.1|:2906468-2906959 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGTAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAATAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCTTTTACGTTTACCAAAGAAATCGATGCGTCCAGCCCG
TATCTCTACAAAGCTGTGACCACCGGACAGACCCTGAAAACGGCAGAATTTAAGTTTTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTACTTCAACATCACGCTTGATAACGTCAAGCTGGTCAGAGTCGCTCCGCT
TATGCACGACATCAAGGATCCTTCCAGAGAGAAGCATAACCACCTGGAACGTATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAGCGTCCTTCCGCCT
GA
 Primer design