SecReT6
Effector Protein ID: 392423185
SecReT6 ID672
T6SS typeN/A
Gene symbol-
Locus tagA458_20755
StrainPseudomonas stutzeri CCUG 29243
Repliconchromosome [GenBank: NC_018028] [Browse all T6SS(s) in this replicon]
Location [Strand]4470885..4471403 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDI4CZ59
KEGG IDpsc:A458_20755
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.20E-40, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|392423185|ref|YP_006459789.1| hypothetical protein A458_20755 [Pseudomonas stutzeri CCUG 29243]
MPTPAYLSLEGTKQGLITAGTFTEDSVGNIFQEGHEDQILVQAFQHQVIIPRDPQSGQPTGQRVHKPLMI
TKVFDKSSPLIFNALTSGERLNKCRLEWYRTSSTGTQEHYFTIELEDAVIVDVQSRMPNCQDPNMSHFTH
LEDVYFTYRKIVWTHEVSGTSGSDDWRTPIAG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|392419087|ref|NC_018028.1|:c4471403-4470885 Pseudomonas stutzeri CCUG 29243 chromosome, complete genome
ATGCCAACACCCGCGTATCTGTCCCTCGAAGGCACCAAGCAAGGCCTGATCACCGCCGGCACCTTCACCG
AGGACTCGGTTGGCAACATCTTCCAGGAAGGCCATGAGGACCAGATCCTGGTGCAGGCCTTCCAGCATCA
GGTCATCATCCCGCGTGACCCGCAGTCCGGCCAGCCGACAGGCCAGCGCGTACACAAGCCGCTGATGATC
ACCAAGGTATTCGATAAGTCGTCGCCGCTGATCTTCAACGCTCTGACTTCCGGCGAGCGCCTGAACAAGT
GCCGTCTGGAGTGGTACCGCACCTCGTCCACCGGCACCCAGGAACACTACTTCACCATCGAACTGGAAGA
TGCGGTGATCGTCGATGTGCAGTCGCGCATGCCCAACTGCCAGGACCCGAACATGTCCCATTTCACTCAT
CTGGAAGATGTGTACTTCACCTACCGCAAGATCGTCTGGACCCACGAGGTGTCCGGCACCTCCGGCTCCG
ACGACTGGCGCACCCCGATCGCTGGCTGA
 Primer design