SecReT6
Effector Protein ID: 397685262
SecReT6 ID681
T6SS typeA1
Gene symbol-
Locus tagPSJM300_00695
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]148285..148803 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDI7A4T1
KEGG IDpsj:PSJM300_00695
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-40, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|397685262|ref|YP_006522581.1| hypothetical protein PSJM300_00695 [Pseudomonas stutzeri DSM 10701]
MPTPAYLSLEGTKQGLITAGTFTEDSVGNIFQEGHEDQILVQAFQHQVIIPRDPQSGQPTGQRVHKPLMI
TKVFDKSSPLIFNALTSGERLNKCRLEWYRTSSTGTQEHYYTIELEDAVIVDVQSRMPNCQDPNMSHFTH
LEDVYFTYRKIVWTHEVSGTSGSDDWRTPIAG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|397685123|ref|NC_018177.1|:148285-148803 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGCCAACCCCCGCGTATCTGTCCCTCGAAGGCACCAAGCAAGGTCTGATCACCGCCGGTACCTTCACCG
AGGATTCGGTCGGCAACATCTTCCAGGAAGGTCATGAAGATCAGATCCTGGTGCAGGCTTTCCAGCACCA
GGTCATCATTCCACGCGACCCGCAGTCGGGTCAGCCCACCGGCCAGCGTGTGCACAAGCCGCTGATGATC
ACCAAGGTCTTCGACAAGTCCTCGCCGCTGATCTTCAACGCCCTGACTTCCGGCGAGCGGCTGAACAAGT
GCCGCCTGGAGTGGTACCGCACCTCCTCGACCGGAACCCAGGAGCACTACTACACCATCGAACTGGAAGA
CGCGGTGATCGTCGACGTGCAGTCGCGCATGCCCAACTGCCAGGACCCGAACATGTCGCATTTCACCCAC
CTGGAAGACGTGTACTTCACCTACCGCAAGATCGTCTGGACCCACGAAGTCTCCGGTACCTCCGGCTCCG
ACGACTGGCGTACCCCGATCGCCGGCTGA
 Primer design