SecReT6
Effector Protein ID: 407710751
SecReT6 ID705
T6SS typeA4b
Gene symbol-
Locus tagBUPH_06121
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome II [GenBank: NC_018672] [Browse all T6SS(s) in this replicon]
Location [Strand]2338723..2339226 [+]
Producttype VI secretion system secreted protein Hcp
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDK0DY93
KEGG IDbpx:BUPH_06121
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.30E-44, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|407710751|ref|YP_006794615.1| type VI secretion system secreted protein Hcp [Burkholderia phenoliruptrix BR3459a]
MKDIYLKFGNPAIKGESADKDHAGWIEIDSWSHAITQPRSATASTAGGHTSERCEHADMVFTKDIDVVSP
LIYQHASGGTTFDEVTIDFMRSDGEGNRIKYLEVKLKYVIISSVTPSVVGEGLPSEQFSLKYAAVQWKYT
QQKIGGNQGGNAQGAWSLTKNDKTYAV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|407708765|ref|NC_018672.1|:2338723-2339226 Burkholderia phenoliruptrix BR3459a chromosome 2, complete sequence
ATGAAGGACATCTATTTAAAATTCGGCAATCCGGCGATCAAAGGCGAGTCCGCCGATAAGGATCACGCTG
GCTGGATCGAAATCGATTCGTGGAGCCACGCAATCACGCAACCGCGTTCGGCGACGGCATCCACCGCAGG
CGGCCACACGTCCGAGCGTTGCGAACACGCCGACATGGTGTTCACGAAAGACATCGACGTGGTGAGCCCG
CTGATTTATCAGCACGCCTCGGGCGGCACGACGTTCGACGAAGTCACGATCGACTTCATGCGTTCGGACG
GTGAAGGCAATCGCATCAAGTACCTCGAAGTGAAGCTCAAATACGTGATCATCTCGAGCGTCACGCCGAG
CGTCGTGGGCGAAGGTTTGCCGAGCGAGCAATTCTCGCTGAAGTACGCTGCCGTGCAGTGGAAGTACACG
CAGCAGAAGATCGGCGGCAATCAGGGCGGCAATGCGCAGGGCGCGTGGAGCCTGACGAAGAACGACAAGA
CCTACGCGGTGTAA
 Primer design