SecReT6
Effector Protein ID: 409248695
SecReT6 ID767
T6SS typeA3
Gene symbol-
Locus tagSENTW_0235
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187073] [Browse all T6SS(s) in this replicon]
Location [Strand]21453..21854 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY0300
DescriptionTae2_TY
UniProt IDE8ZXW6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 133 a.a.     [Download]
>gi|409248695|ref|YP_006884535.1| hypothetical protein SENTW_0235 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MPYVYANAKALQDTEKVGNHHQCVELIQHYIRVGQTSTWQQGAAVFGNKNIEVGTVIATFVNGRYPNHNS
GNHAAFFLGQDAGGIWVMDQWKDDIAKPRVSKRYIRKLHNGSVRSDGTYIRMSNNAEAYFIVE
-
Nucleotide Sequence: 402 bp     [Download]
>gi|409248675|ref|NT_187073.1|:21453-21854 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGCCATATGTTTATGCTAATGCAAAGGCTTTACAGGATACAGAAAAGGTAGGAAACCACCATCAGTGTG
TTGAACTTATTCAACACTATATACGAGTAGGACAAACGAGTACATGGCAGCAAGGGGCCGCAGTATTTGG
AAACAAAAACATTGAAGTCGGGACAGTTATCGCTACTTTTGTGAATGGGCGATATCCGAACCACAATAGT
GGCAACCATGCTGCATTTTTTCTGGGGCAAGATGCTGGCGGGATATGGGTGATGGATCAATGGAAAGATG
ATATCGCAAAACCCCGTGTGTCCAAACGTTATATAAGAAAGTTGCATAATGGAAGTGTTCGTAGTGACGG
GACTTATATAAGGATGAGTAATAATGCAGAAGCCTATTTTATCGTTGAATAG
 Primer design