SecReT6
Effector Protein ID: 410481011
SecReT6 ID699
T6SS typeA4b
Gene symbol-
Locus tagO3M_04410
StrainEscherichia coli O104:H4 str. 2009EL-2050
Repliconchromosome [GenBank: NC_018650] [Browse all T6SS(s) in this replicon]
Location [Strand]894268..894774 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4564
DescriptionAaiC protein
UniProt IDJ9ZIU0
KEGG IDesm:O3M_04410
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 168 a.a.     [Download]
>gi|410481011|ref|YP_006768557.1| hypothetical protein O3M_04410 [Escherichia coli O104:H4 str. 2009EL-2050]
MVGVMSNSSALSREFVKIEIGGKVIKGNSKVENSGDYFDGHCPQAFHAFSGIDGTVFDLINLKLRVTKHI
QDLLENFFKRGEKEVKIEILRRESTKSGSAYSSFKVVYQGCRMHNMLLAHDNDSNLILELSFTPEESVSI
EMNIPSDDGKSTEKLGPMTYNLYKEALV
-
Nucleotide Sequence: 507 bp     [Download]
>gi|410480139|ref|NC_018650.1|:894268-894774 Escherichia coli O104:H4 str. 2009EL-2050 chromosome, complete genome
ATGGTCGGAGTTATGAGTAATTCTTCCGCTCTTAGCAGGGAGTTTGTCAAAATAGAGATAGGTGGAAAAG
TTATAAAGGGAAATTCAAAAGTTGAAAACAGTGGTGACTACTTTGATGGACATTGTCCTCAGGCATTTCA
CGCTTTTTCAGGAATTGACGGTACTGTTTTTGATTTAATTAATTTGAAGCTTAGGGTTACTAAACACATA
CAAGACCTTCTGGAGAACTTTTTTAAGAGAGGTGAAAAAGAAGTTAAAATAGAAATTTTACGTAGGGAAT
CAACTAAATCAGGTAGTGCATACTCATCATTTAAGGTTGTTTATCAGGGGTGTCGTATGCATAATATGTT
GTTGGCTCATGATAATGATTCAAATCTCATTCTGGAATTGTCGTTTACCCCAGAAGAGAGTGTCTCAATT
GAGATGAATATTCCGTCAGATGATGGAAAAAGTACGGAGAAATTGGGACCAATGACGTACAACTTATATA
AAGAGGCTCTTGTATAA
 Primer design