SecReT6
Effector Protein ID: 45443404
SecReT6 ID59
T6SS typeA3
Gene symbolvgrG5
Locus tagYP_3672
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]4180845..4183193 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorYPK_3558
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ7CG97
KEGG IDype:YPO0507, ypk:y3668, ypm:YP_3672
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 25..328
Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 535..589
Phage_GPD [PF05954], Evalue: 3.40E-64, Aligned region: 637..669
Phage_base_V [PF04717], Evalue: 2.30E-23, Aligned region: 365..457
Protein Sequence: 782 a.a.     [Download]
>gi|45443404|ref|NP_994943.1| hypothetical protein YP_3672 [Yersinia pestis biovar Microtus str. 91001]
MQLIEIENEVLSGQDAFPLSFKTQEKVSGNPSYQLVFQVAEADLDLVSLLGEIIKVRIELPDSAGYRTFF
TYVIAGADEGQRQDKFVYSLELSTWTWFLMQNRNCRIFQDLNIIDIIEQVFSKYNFADYRFDIVGNYRLR
EYCVQFAETDFDFVNRLMEDEGVWYYFEHNEDKHTLVMTDQQQFPVLEGHYAELSFLPDSEEMRAIREGI
QRIQRSQRIHSSEIVLRDFDFLNPRNTLQTHIEESRQHLQGVPLEWYDYAAGYTDPQHGESIARLRLEAI
QSNGQLLSGESNATGLVPGRSFALVQHPDNNRNRGFKLISCDYSFVQDGPDSASQGRNVACKFKALNDDV
VYRPQCVTPPPKVPGVQSATVVGARESEVHTDKFARIRVHFHWDRYKTTEDDSSCWIRVVQAWAGKGWGV
LAMPRVGQEVLVNYVDGDLDRPMVTGIVYNGENPPPYRLPDHINYSGFVSRSLRFGQPQHASQLTFDDNR
GNERIMLHAERDLQRTVERNSATAVGQDKYDTVERTATEWINNHISYKDFSFSVTGMSVSATGISVSTTG
TSLSVTGMSTSVTGVSVGFTLIGTSFTGVSTSFTGVGTSFTGASNSLTGVSNSMTGCSSSFTGTSNSMTG
SSHSMTGMSTSITGHSMSQTGSSSSITGDSTSFTGSSVSSTGSSVSTTGVSTSTTGSSTSTTGCSVSTTG
SSTSTTGNSVSMTGNSTSTTGCSISTTGSSIGTVGSSISTTGSSVSTTGSSISTTGLSVSYTGAQYSDVG
VDLKTVGMQSKN
-
Nucleotide Sequence: 2349 bp     [Download]
>gi|45439865|ref|NC_005810.1|:c4183193-4180845 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGCAATTAATTGAGATAGAGAATGAGGTTTTATCGGGCCAGGATGCTTTTCCTCTCTCCTTCAAGACGC
AGGAAAAAGTGTCAGGGAATCCATCCTACCAACTGGTATTTCAGGTAGCAGAAGCGGATCTCGATCTGGT
CAGTTTGCTGGGGGAAATCATCAAAGTCAGGATTGAGTTACCTGACTCAGCCGGCTACCGGACCTTTTTT
ACCTATGTGATCGCCGGTGCTGATGAAGGGCAACGGCAAGACAAATTTGTTTACAGCCTGGAACTGAGTA
CCTGGACGTGGTTTTTGATGCAAAACCGCAACTGCCGGATATTTCAGGACCTGAATATTATCGATATTAT
CGAACAGGTATTCTCCAAATATAACTTTGCGGATTACCGTTTTGATATCGTCGGTAACTATCGATTACGC
GAGTACTGCGTACAGTTTGCAGAAACCGATTTCGACTTTGTTAATCGTCTGATGGAAGACGAAGGCGTTT
GGTATTACTTCGAACATAACGAAGATAAGCACACGCTGGTCATGACAGATCAGCAACAATTCCCTGTATT
GGAAGGGCATTATGCAGAACTGAGTTTCCTGCCTGACAGTGAAGAGATGCGCGCCATCCGTGAGGGGATA
CAGCGTATTCAACGCTCACAACGCATCCACTCCAGCGAAATTGTCTTACGTGACTTCGATTTCCTTAATC
CACGCAATACATTACAAACCCATATCGAAGAAAGCCGCCAACACCTGCAAGGCGTGCCACTGGAATGGTA
TGACTACGCGGCGGGTTACACCGATCCCCAGCATGGTGAGAGCATCGCCCGTTTACGCCTTGAAGCTATA
CAGAGTAATGGGCAGCTCTTGTCTGGTGAAAGTAATGCCACAGGATTAGTGCCAGGGCGCTCTTTTGCTC
TGGTACAGCACCCTGATAACAACCGTAATCGGGGATTCAAACTGATCAGTTGTGACTACAGTTTTGTCCA
GGATGGGCCGGACAGTGCGAGCCAGGGACGTAATGTCGCCTGTAAGTTTAAGGCATTGAATGATGACGTC
GTTTATCGTCCACAATGTGTCACGCCACCGCCAAAGGTCCCTGGTGTGCAAAGTGCCACAGTGGTCGGTG
CGCGTGAATCAGAAGTGCATACCGATAAGTTCGCCCGTATTCGCGTTCACTTTCACTGGGATCGTTATAA
AACCACCGAAGATGATAGCTCCTGCTGGATCCGCGTTGTACAGGCGTGGGCCGGTAAAGGCTGGGGCGTC
CTGGCGATGCCTCGGGTCGGGCAAGAAGTGCTGGTCAATTACGTTGACGGCGACCTTGATCGCCCGATGG
TGACCGGGATCGTCTACAACGGTGAGAACCCACCGCCTTACCGTTTACCTGACCACATTAACTACTCCGG
TTTTGTCTCACGCTCACTGCGCTTTGGTCAGCCACAACACGCCAGCCAGCTTACCTTCGATGATAATCGG
GGCAATGAGCGGATCATGCTACATGCTGAGCGCGACTTACAAAGAACGGTTGAACGTAACAGTGCGACGG
CCGTCGGTCAGGATAAATACGACACGGTGGAACGGACGGCCACGGAGTGGATCAACAACCATATCTCCTA
CAAAGACTTCAGTTTCTCGGTGACGGGCATGAGTGTCTCCGCGACGGGCATCAGTGTCTCGACAACGGGA
ACGAGCTTATCTGTCACCGGCATGAGCACCAGCGTCACGGGTGTCAGTGTGGGTTTCACCTTGATAGGGA
CCTCCTTTACGGGGGTGAGCACATCGTTTACCGGTGTCGGTACCTCCTTCACCGGGGCCAGCAACTCGCT
AACCGGTGTCAGCAACTCGATGACCGGGTGTAGTTCCTCCTTTACCGGTACTAGCAATAGCATGACAGGC
AGTAGCCATAGCATGACCGGCATGAGCACCAGCATCACCGGGCATAGCATGAGTCAGACGGGTTCCAGTA
GCAGCATCACCGGTGACAGTACCTCCTTTACCGGCAGCAGCGTCAGCAGTACGGGCAGCAGCGTCAGTAC
GACCGGTGTCAGTACCAGCACTACGGGGAGTAGCACCTCGACTACCGGTTGTAGCGTCAGTACTACGGGT
AGCAGCACCTCGACTACCGGTAATTCAGTCAGCATGACCGGTAACAGCACCAGTACCACGGGATGCAGTA
TTTCCACGACGGGCAGCAGTATTGGGACGGTAGGAAGCAGTATCAGCACCACGGGCAGTAGCGTCAGTAC
CACCGGTAGCAGTATCAGCACCACGGGATTATCCGTCAGTTATACCGGCGCTCAATATTCCGATGTGGGT
GTCGATCTGAAAACCGTTGGCATGCAAAGCAAAAACTGA
 Primer design