SecReT6
Effector Protein ID: 472325548
SecReT6 ID744
T6SS typeA4a
Gene symbol-
Locus tagH681_11920
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]2636050..2636568 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDM4WWR2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.10E-40, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|472325548|ref|YP_007657794.1| hypothetical protein H681_11920 [Pseudomonas denitrificans ATCC 13867]
MPTPAYLSLEGTKQGLITAGTFTEDSVGNIFQEGHEDQILVQAFNHQVIIPRDPQSGQPTGQRVHKPLMI
TKVFDKSSPLIFNALTSGERLNKCRLEWYRTSSTGTQEHYFTIELEDAVIVDVQSRMPNCQDPNMAHFTH
LEDVYFTYRKIVWTHEVSGTSGSDDWRTPISA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|472323176|ref|NC_020829.1|:2636050-2636568 Pseudomonas denitrificans ATCC 13867, complete genome
ATGCCAACACCCGCGTATCTGTCCCTCGAAGGCACCAAGCAAGGCCTGATCACCGCCGGCACCTTCACCG
AGGACTCGGTCGGCAACATCTTCCAGGAAGGTCACGAAGACCAGATTCTGGTTCAGGCCTTCAACCACCA
GGTCATCATCCCGCGTGATCCGCAGTCCGGCCAGCCGACCGGTCAGCGCGTGCACAAGCCGCTGATGATC
ACCAAGGTCTTCGACAAGTCCTCGCCGCTGATCTTCAACGCCCTGACCTCCGGCGAGCGTCTGAACAAGT
GCCGCCTGGAGTGGTACCGCACTTCCTCCACCGGTACCCAGGAGCACTACTTCACCATCGAGCTGGAAGA
CGCGGTGATCGTCGACGTGCAGTCGCGCATGCCGAACTGCCAGGACCCGAACATGGCGCACTTCACTCAC
CTGGAAGACGTCTACTTCACCTACCGCAAGATCGTCTGGACCCACGAAGTCTCCGGCACCTCCGGCTCCG
ACGACTGGCGCACCCCGATCTCTGCCTGA
 Primer design