SecReT6
Effector Protein ID: 478479574
SecReT6 ID748
T6SS typeA1
Gene symbol-
Locus tagG655_16925
StrainPseudomonas aeruginosa B136-33
Repliconchromosome [GenBank: NC_020912] [Browse all T6SS(s) in this replicon]
Location [Strand]3733037..3737881 [+]
ProductRhs family protein
Effector typeProtein
Homologous effectorPA14_43100
DescriptionRhsP2
UniProt IDM9S1Q6
KEGG IDpsg:G655_16925
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 562..582
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 632..656
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 698..733
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 739..768
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 801..836
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 842..878
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 884..920
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 929..957
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 970..1001
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 1017..1049
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 1057..1085
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 1077..1104
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 1135..1147
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 1138..1173
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 1163..1197
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 1184..1211
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 1238..1276
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 1265..1290
RHS_repeat [PF05593], Evalue: 3.00E-64, Aligned region: 1344..1362
RHS [PF03527], Evalue: 1.40E-14, Aligned region: 816..836
RHS [PF03527], Evalue: 1.40E-14, Aligned region: 904..916
RHS [PF03527], Evalue: 1.40E-14, Aligned region: 1237..1248
RHS [PF03527], Evalue: 1.40E-14, Aligned region: 1328..1336
RHS [PF03527], Evalue: 1.40E-14, Aligned region: 1344..1380
Protein Sequence: 1614 a.a.     [Download]
>gi|478479574|ref|YP_007710225.1| Rhs family protein [Pseudomonas aeruginosa B136-33]
MISSFYAMFMLRGVNAKQPDASQLIGEFSSGVLNRYEEYANSWLWGWALDVQQTIALSDGNGNELTRLKA
DKDANILEDVASCPVNGQLKLLHTFESTSFVPIGNTPYEITRIGSRTPQFKGVLDADGMASISGCAPNTL
YQVKFYPEVSIQEIDALYRSYDDVIAKLNEWLLEQWNGPLSAEWKRLAPVGDRRRMEQINDAYLDGMGKA
LVNLWDDVVELFGILANLDEHAAKLLEFINEADFEKLKAQAKELLGTALLIASDEPLLFIYASAIVCWTQ
LLPPTTAAEMVAELSTGLLLDILLGIILTGGAGLAVRLAVKGSKAIKASEGAMLLRKAMQVLFDTSCRHS
LQLHAEKLKPLAVRGEVMANSSNKITAQIQSTAQGIARTEPDTLPLSRGKRANTSLSSSQATPDASAPGR
TPAGKPADQAAQTCVKDCPVSMVTGEELLTLTDCELDGPLRFAWTRLYRTSAAEIDNGLGFGWSHALSHR
LDRDGDELVWTDHENRRTRFPIPDAQRPAITNRLSRAAIYLGGDPSELILAQAGEKPRFYHFRKDPDGAY
LIAISDAYGNRLELSRDRLGRPRRLSHKAGRALLLCYQGRHIERVEYQVYQPADNLEACWHTTQVLARYR
CNERGQLIEAGNALYEAERYRYDARNVILERQLAGGASFFWEWEGEGKQARAVHHWASFPQMDSRYVWNE
DGSVTAINADGSEEVYVHDDNARLVRQVDPDGGETLRHYDEKGQLVAERDPLGTITEYRYDQAGRLEALL
PAEGEPTCYSYFDGLVRSVRRGEAQWKYERNAQGDITRQTDPEGNVTHYAYDHRGCLVEITHADGSLHQL
TWNPLGQLIEEQLPDGSVRRYRYDTLGRQITRQDESGAITRFQWDAAGRLSQITLPGGASRMYRYNAYGK
VTSECDEQGRMTRYEYLDDLHLVSRRINPDGSQLRYRYENARLLLSEIENERGERYRLDYHGNGLISQET
GFDGRRTAYRYDLKGQLLEKTEYGDDGSELRTTYQRDSTGRLLAKTLPDGNRVDYRYDTLGRLVAVDDGT
WPLAYEYDLRDRLVREHQGWATLHYAYDALGQLIHCRLPDGNRVDYRYQTGGTLSAIDLNGQSLTRHQFG
SGRERQRQQGELLSQYHYDEQGRLLAHQVSQRQRHLYQRQYRYDASGNLAAIEDSRKGIRSFHYDPLDRL
LGVRGETPESFVHDPAGNLLAQGGQFDARQMEVRGNRLLTQGDRHFDYDAHGNLVRERRGTGQKLVTEYS
YDCQHRLIGVSLPDGRQVAYRYDAFGRRIAKQVDGRNTEFLWLGERLLAESGDRHYRTYLYEPDSFRPLA
LLDGEGPEQVEPCYYQLDHLGTPQELTRADGRLCWSARYRAYGNVLKLDIAEVDNPLRFQGQYFDAETGL
HYNRHRYYNPSTGRYLTPDPIRLAGGLNSYRYVPNPTGWVDPLGLASNKTRCPEALDNNPRKGINSTSGS
KKPAGPIVELDAQGNEIYYRTLSEQHLEILRNNFEVPPTSETFISPLQSYSQEYDGKLVRLTASPGTMNE
LSKIGVTANSGTGLLLPDLPPARKGWKQNNALFKLEALKKLTINEGGGVINTGLGDGKALEIFNKNLIDF
EVID
-
Nucleotide Sequence: 4845 bp     [Download]
>gi|478476202|ref|NC_020912.1|:3733037-3737881 Pseudomonas aeruginosa B136-33, complete genome
ATGATCTCGTCGTTCTACGCCATGTTCATGCTGCGCGGAGTGAACGCGAAGCAGCCGGATGCCAGCCAGT
TGATCGGCGAATTCAGCTCCGGGGTGCTCAACCGCTATGAGGAATATGCGAACAGTTGGCTCTGGGGCTG
GGCACTCGACGTCCAGCAGACCATCGCCCTTTCCGATGGGAACGGCAACGAGTTGACCAGGCTGAAAGCC
GACAAGGACGCCAACATCCTCGAAGACGTCGCCTCATGTCCGGTCAACGGTCAACTGAAACTGCTGCATA
CTTTCGAATCGACCAGTTTCGTGCCCATCGGCAACACGCCTTACGAAATCACTCGGATAGGCAGCAGGAC
ACCGCAGTTCAAGGGCGTACTGGATGCAGATGGGATGGCGAGCATAAGCGGCTGCGCTCCCAATACGCTG
TACCAGGTCAAGTTCTACCCAGAGGTAAGCATCCAGGAGATCGACGCGCTCTACCGCTCCTACGACGACG
TAATCGCCAAGCTGAACGAATGGCTTCTGGAGCAATGGAACGGCCCGCTTTCCGCCGAATGGAAAAGGCT
CGCGCCGGTTGGCGACCGTAGGCGGATGGAGCAGATAAACGACGCCTATCTGGACGGCATGGGCAAAGCG
CTGGTCAATCTCTGGGATGATGTGGTCGAGCTGTTCGGCATCCTCGCGAACCTCGACGAGCACGCGGCGA
AACTCCTTGAGTTCATCAACGAAGCGGATTTCGAAAAGCTCAAGGCTCAGGCCAAGGAACTCCTCGGTAC
CGCCTTGCTGATCGCCAGCGACGAACCGCTTCTGTTCATCTATGCCAGCGCCATCGTGTGCTGGACCCAG
TTGCTGCCGCCCACGACTGCCGCGGAAATGGTCGCGGAACTCTCCACCGGCCTGCTCCTCGATATTCTGC
TCGGCATCATCCTGACCGGCGGAGCCGGTCTCGCCGTTCGCCTGGCCGTCAAGGGCTCGAAAGCGATCAA
GGCCTCCGAAGGTGCGATGCTGCTGCGCAAAGCCATGCAGGTGCTGTTCGATACCAGTTGTCGGCATTCC
CTCCAGTTGCACGCGGAAAAGCTGAAACCTCTGGCCGTCCGCGGTGAAGTGATGGCCAACAGCTCCAACA
AGATCACCGCACAGATCCAGAGCACCGCCCAAGGCATCGCCCGCACCGAGCCCGACACCCTGCCGCTGAG
CCGAGGAAAGCGCGCGAACACCTCGCTCTCCAGCAGTCAGGCGACGCCCGATGCCTCCGCACCCGGCAGG
ACGCCCGCCGGCAAACCCGCCGACCAGGCCGCCCAGACCTGCGTCAAGGACTGTCCCGTTTCGATGGTCA
CCGGCGAGGAGCTGCTGACCCTGACCGACTGCGAGCTAGACGGTCCGCTGCGTTTCGCCTGGACGCGCCT
GTACCGCACCAGCGCGGCGGAAATCGACAATGGTCTGGGCTTCGGCTGGAGCCATGCCCTCTCCCATCGC
CTCGATCGCGACGGCGACGAGCTGGTATGGACCGATCACGAGAACCGCCGGACCCGCTTCCCGATCCCTG
ACGCCCAGCGCCCGGCGATCACCAACCGACTGTCGCGCGCCGCCATCTACCTCGGCGGCGACCCATCCGA
ACTGATCCTTGCCCAGGCCGGCGAAAAGCCGCGCTTCTACCACTTCCGCAAAGACCCGGACGGCGCTTAC
CTGATCGCCATCAGCGACGCCTACGGCAACCGCCTGGAACTGAGTCGCGACCGCCTCGGCCGGCCGCGCC
GCCTCAGCCACAAGGCCGGGCGCGCGCTACTGCTGTGCTACCAGGGCAGGCACATCGAGCGCGTCGAGTA
CCAGGTGTACCAGCCCGCCGATAACCTGGAGGCCTGCTGGCACACCACCCAGGTACTCGCCCGCTACCGC
TGCAACGAACGTGGCCAGTTGATCGAAGCCGGAAACGCACTCTACGAGGCCGAACGCTATCGCTACGACG
CGCGCAATGTCATCCTCGAGCGCCAGTTGGCCGGCGGCGCCTCGTTCTTCTGGGAATGGGAAGGCGAAGG
CAAGCAGGCCCGCGCGGTCCATCACTGGGCCAGCTTCCCGCAGATGGACTCGCGCTACGTCTGGAACGAA
GACGGCAGCGTTACCGCGATCAACGCCGACGGCAGCGAGGAAGTCTATGTCCACGACGACAACGCGCGCC
TGGTACGCCAGGTCGATCCCGACGGAGGCGAAACCCTCAGGCACTACGACGAGAAGGGCCAACTGGTCGC
CGAACGCGATCCGTTGGGAACGATCACCGAGTACCGCTACGACCAGGCCGGACGCTTGGAGGCACTGCTC
CCGGCCGAAGGCGAGCCAACCTGCTATAGCTACTTCGACGGCCTCGTGCGCAGCGTGCGCCGCGGCGAGG
CGCAGTGGAAGTACGAGCGCAACGCTCAGGGCGACATCACCCGCCAGACCGATCCCGAAGGCAACGTCAC
CCACTACGCCTACGACCACCGCGGCTGCCTGGTGGAAATCACCCATGCCGACGGCAGCCTGCACCAGTTG
ACCTGGAATCCGCTCGGCCAGTTGATAGAAGAACAGCTTCCGGACGGTAGCGTGCGCCGCTATCGCTACG
ACACACTGGGTAGACAGATCACCCGCCAGGACGAAAGCGGCGCCATCACCCGGTTCCAGTGGGATGCAGC
AGGCCGCCTGAGCCAGATCACCCTGCCCGGTGGCGCCAGCCGCATGTACCGCTACAACGCTTACGGCAAG
GTCACCAGCGAGTGCGACGAACAGGGCCGGATGACCCGCTACGAATATCTTGACGACCTGCACCTGGTCA
GCCGGCGGATCAACCCGGACGGCAGTCAGCTGCGCTACCGCTACGAAAACGCCCGGCTACTGCTCAGCGA
GATCGAGAACGAACGCGGCGAACGCTATCGCCTCGATTACCACGGCAACGGCCTGATCAGCCAGGAAACC
GGCTTCGACGGCCGCCGCACCGCCTATCGCTACGACCTCAAAGGCCAGCTTCTGGAGAAAACCGAGTACG
GCGACGACGGCAGCGAACTGCGCACCACCTACCAGCGCGACAGTACCGGGCGCCTGCTGGCGAAGACACT
GCCCGACGGCAATCGGGTCGACTACCGCTACGATACGCTCGGACGCCTGGTCGCCGTCGACGACGGCACC
TGGCCGCTGGCCTACGAATACGACCTACGGGACCGCCTGGTCCGCGAGCACCAGGGCTGGGCCACCCTTC
ACTACGCCTACGACGCCCTCGGCCAGTTGATCCACTGCCGACTGCCCGACGGCAACCGCGTCGACTACCG
CTACCAGACCGGCGGCACCCTCTCGGCAATCGATCTCAACGGCCAGTCCCTGACCCGGCACCAGTTCGGT
AGCGGTCGCGAACGCCAGCGCCAGCAGGGCGAACTGCTCAGCCAATACCACTACGATGAGCAGGGCCGCC
TGCTGGCCCACCAGGTCAGTCAGCGGCAGCGCCATCTCTACCAGCGCCAGTACCGCTATGACGCTAGCGG
CAACCTGGCCGCCATCGAGGACAGCCGCAAGGGCATTCGCAGCTTCCACTACGACCCGCTGGACCGCCTG
CTCGGCGTACGCGGTGAAACCCCGGAAAGCTTCGTGCACGACCCGGCCGGCAACCTGCTCGCCCAGGGCG
GGCAATTCGACGCGCGACAGATGGAGGTTCGCGGAAATCGCCTGCTGACGCAGGGCGACCGGCATTTCGA
CTACGACGCCCACGGCAATCTCGTTCGCGAACGCCGCGGCACCGGGCAGAAGCTGGTCACCGAATACAGC
TACGACTGCCAACACCGCCTGATCGGCGTCAGCCTGCCGGACGGGCGCCAGGTCGCCTACCGCTACGACG
CCTTCGGCCGACGCATCGCCAAGCAGGTCGACGGGCGCAATACCGAGTTCCTCTGGCTCGGCGAACGCCT
GCTCGCCGAGAGCGGCGACCGGCACTACCGCACCTATCTCTACGAACCCGACAGCTTTCGCCCGCTGGCC
CTGCTCGACGGCGAAGGCCCGGAACAGGTCGAACCCTGCTACTACCAACTCGACCACCTCGGTACCCCGC
AGGAACTGACCCGCGCCGATGGCCGCCTCTGCTGGTCGGCGCGCTACCGGGCTTACGGCAATGTGCTCAA
GCTGGACATCGCCGAAGTGGATAACCCACTGCGCTTCCAGGGCCAGTATTTCGACGCCGAGACCGGGCTG
CACTACAACCGCCATCGCTACTACAATCCAAGCACGGGACGCTACCTGACCCCCGATCCGATCAGGCTGG
CAGGTGGGTTGAACAGCTACCGGTACGTGCCGAATCCGACGGGGTGGGTGGACCCGTTGGGGCTGGCCTC
AAATAAAACTCGCTGTCCCGAAGCATTAGACAATAATCCCCGCAAAGGGATTAACTCCACATCCGGCAGC
AAAAAGCCGGCAGGACCAATCGTAGAGTTGGATGCGCAGGGAAACGAGATTTACTACCGAACACTAAGCG
AGCAGCACCTTGAGATACTGAGGAACAACTTTGAAGTACCTCCGACGAGTGAGACCTTCATCTCCCCGCT
ACAATCCTACTCCCAAGAGTATGATGGGAAATTAGTAAGACTTACAGCCAGTCCAGGCACCATGAATGAG
CTGTCTAAAATTGGAGTAACTGCAAATTCCGGAACCGGCCTATTGCTTCCAGATCTCCCTCCCGCCCGAA
AGGGCTGGAAACAGAACAACGCACTATTCAAACTCGAAGCACTAAAAAAGCTAACGATAAATGAAGGAGG
CGGCGTTATCAACACTGGCCTTGGGGATGGAAAAGCCCTAGAGATTTTCAACAAGAACCTAATAGACTTC
GAAGTAATAGACTAG
 Primer design