SecReT6
Effector Protein ID: 488607066
SecReT6 ID759
T6SS typeA1
Gene symbolhcpC
Locus tagBTI_3984
StrainBurkholderia thailandensis MSMB121
Repliconchromosome II [GenBank: NC_021174] [Browse all T6SS(s) in this replicon]
Location [Strand]456169..456657 [+]
Productmajor exported protein
Effector typeProtein
Homologous effectorBTH_II0868
DescriptionHcp protein
UniProt IDN0ASD6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.40E-40, Aligned region: 6..146
Protein Sequence: 162 a.a.     [Download]
>gi|488607066|ref|YP_007920445.1| major exported protein [Burkholderia thailandensis MSMB121]
MPMPCYLTLEGETQGNIEGSCAIAGHENKILVQGVEHKIEIPKNLQTGLPTGPRIHGPMMLTKEIDKSSP
KLAQALTSGEHMKSVVLEYWRINKDGKQEHYYTVKLENAILMEIRSWTPNCLVLDNKELSHMEDVSFTYE
KITWTYVLDGIEAEDSWLTPKK
-
Nucleotide Sequence: 489 bp     [Download]
>gi|488605303|ref|NC_021174.1|:456169-456657 Burkholderia thailandensis MSMB121 chromosome 2, complete sequence
ATGCCGATGCCGTGCTATCTCACGCTCGAAGGGGAAACCCAGGGCAACATCGAGGGCTCCTGCGCCATCG
CGGGCCACGAGAACAAGATTCTCGTCCAGGGCGTCGAGCACAAGATCGAGATCCCGAAGAACCTGCAGAC
CGGCCTGCCGACCGGCCCGCGAATTCACGGGCCGATGATGCTGACGAAGGAGATCGACAAGTCGTCGCCG
AAGCTGGCGCAGGCGCTCACGTCCGGCGAGCACATGAAGTCGGTCGTGCTCGAGTACTGGCGGATCAATA
AGGATGGCAAACAAGAGCATTACTACACGGTCAAGCTCGAGAACGCGATCCTGATGGAAATCCGCTCGTG
GACGCCGAACTGCCTCGTGCTCGACAACAAGGAGCTCAGTCACATGGAAGACGTGTCGTTCACCTACGAG
AAGATCACGTGGACCTACGTGCTGGACGGCATCGAGGCCGAAGACTCATGGCTCACACCGAAGAAGTGA
 Primer design