SecReT6
Effector Protein ID: 501680484
SecReT6 ID764
T6SS typeA3
Gene symbol-
Locus tagPFLCHA0_c30360
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]3384775..3387024 [-]
ProductRhs-family protein
Effector typeProtein
Homologous effectorPA0095
Descriptiontype VI secretion system Vgr family protein
UniProt IDR4R8Z7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-86, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 1.50E-86, Aligned region: 346..372
Phage_base_V [PF04717], Evalue: 2.50E-25, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 8.80E-15, Aligned region: 5..13
Gp5_C [PF06715], Evalue: 8.80E-15, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 8.80E-15, Aligned region: 530..552
Gp5_C [PF06715], Evalue: 8.80E-15, Aligned region: 554..576
Gp5_C [PF06715], Evalue: 8.80E-15, Aligned region: 562..584
Gp5_C [PF06715], Evalue: 8.80E-15, Aligned region: 578..599
Gp5_C [PF06715], Evalue: 8.80E-15, Aligned region: 603..616
Gp5_C [PF06715], Evalue: 8.80E-15, Aligned region: 644..664
Gp5_C [PF06715], Evalue: 8.80E-15, Aligned region: 657..680
Gp5_C [PF06715], Evalue: 8.80E-15, Aligned region: 666..684
DUF2345 [PF10106], Evalue: 0.0062, Aligned region: 613..737
Protein Sequence: 749 a.a.     [Download]
>gi|501680484|ref|YP_008000310.1| Rhs-family protein [Pseudomonas protegens CHA0]
MAITQNNRLVQVDSPLGGDVLLLQSMEGNEELGRLFHYELDLTSENRAITFDQLLGKPMGLTLELHDGSK
RYFHGVVCSCRQVNGHGQFAGYRVSLRPWLWLLTRTSDCRIFQNKTVPEIIKQVFRDLGFSDFEDSLSGN
YREWEYCVQYRETSFDFVSRLMEHEGIYYYFRHEQARHVLVFADAYGAHSTVADYDSVPFYPPDRQMRER
DHFYDWQLEREVQPGSLELNDYDFKRPRARLEVRSSVSRSHSNGDHPLYDYPGEYVQSNDGEHYARTRIE
AIHSQFERVQLRGRARGLGCGHLFKLTGYEREDQNREYLVVFARYQIRQELYENAQLDLSEQFTSELDCM
DASQAFRPLPLTPMPIVRGPQTAVVVGPDGEEIWTDQYGRVKVHFYWDRHDQSNANSSCWMRVSQAWAGK
NWGAVQIPRIGQEVIVSFIEGNPDRPIITGRVYNAEQTVPYTLPANATQSGVKSRSSKDGSPANFNEIRM
EDKKGAEQLFIHAEKNQDIEVENDETHWVGHDRSKTIDNDETVHVKHDRTETVDHNETITIGVNRTESVG
NNEDISIGVNRTESVGSNETISIGLNRTISVGASETATVALQRTHAVGINETIAIGAAQEVVIGAFQTVN
VGAYQNVNVGLYQSTNVGTNRSVDVGANLSTTVKDNESRQVGAGRTTDIGKDDELTVGKNLVIDAGDSVT
IMTGKASIVMKKDGTISISGKDITIDGSGVINIKANKNVVIKGRKILQN
-
Nucleotide Sequence: 2250 bp     [Download]
>gi|501677485|ref|NC_021237.1|:c3387024-3384775 Pseudomonas protegens CHA0, complete genome
ATGGCAATAACGCAAAACAACCGTTTGGTGCAGGTCGACAGTCCCCTCGGCGGCGATGTCCTGTTGCTGC
AGAGCATGGAAGGCAACGAAGAGCTGGGGCGATTGTTCCACTACGAATTGGACCTCACCTCCGAAAACCG
AGCGATCACATTCGACCAGTTGCTGGGCAAGCCGATGGGCCTGACCCTGGAGCTGCACGACGGCAGCAAA
CGCTATTTCCACGGCGTTGTCTGCAGCTGCCGGCAAGTGAACGGCCACGGTCAGTTCGCCGGCTACCGCG
TCAGCCTGCGGCCCTGGTTATGGCTGCTCACGCGCACTTCGGACTGCCGGATTTTCCAGAACAAAACGGT
GCCGGAGATCATCAAGCAGGTGTTCCGCGACCTCGGTTTCTCCGATTTCGAAGACAGCCTGAGCGGCAAC
TACCGCGAGTGGGAATATTGCGTGCAGTACCGTGAAACCAGCTTTGACTTCGTCAGCCGGTTGATGGAGC
ACGAAGGCATCTATTACTACTTTCGCCATGAGCAGGCGCGTCATGTACTGGTGTTTGCCGACGCCTATGG
CGCCCACTCCACGGTGGCCGACTATGACTCGGTGCCCTTCTACCCGCCCGATCGGCAAATGCGCGAGCGC
GACCATTTCTACGATTGGCAACTGGAGCGGGAAGTCCAACCCGGTTCTCTGGAGCTAAACGACTACGACT
TCAAGCGCCCCCGCGCCAGACTGGAGGTGCGCTCCAGTGTGTCGCGCAGTCACAGCAACGGCGACCACCC
GCTCTACGACTACCCCGGTGAATACGTTCAGAGCAACGACGGCGAGCACTACGCGCGTACCCGCATCGAA
GCCATTCACAGCCAGTTCGAGCGCGTGCAGCTGCGCGGCCGCGCCCGCGGGCTGGGCTGCGGCCATTTGT
TCAAGCTGACCGGCTACGAGCGCGAGGACCAGAACCGCGAATACCTGGTGGTGTTCGCACGCTATCAGAT
CCGCCAGGAACTCTATGAAAATGCGCAGCTGGACCTGTCCGAGCAGTTCACCAGCGAGCTGGACTGCATG
GATGCCAGCCAGGCCTTCCGCCCTCTTCCCCTGACCCCCATGCCCATTGTTCGCGGGCCGCAGACCGCCG
TGGTGGTCGGCCCCGATGGCGAGGAGATCTGGACCGACCAGTATGGCCGGGTCAAAGTGCATTTCTACTG
GGACCGCCACGACCAGTCCAATGCCAATAGCTCCTGCTGGATGCGCGTGTCCCAGGCCTGGGCCGGCAAG
AACTGGGGGGCGGTGCAGATCCCGCGAATCGGTCAGGAAGTGATCGTCAGTTTCATCGAAGGCAACCCGG
ATCGGCCGATCATCACTGGCCGCGTCTACAACGCCGAACAGACCGTGCCCTACACGCTACCGGCCAATGC
CACTCAGAGCGGGGTGAAAAGCCGTTCGAGCAAGGACGGCTCACCGGCCAACTTCAATGAAATCCGCATG
GAGGACAAGAAAGGTGCAGAGCAACTGTTTATCCATGCCGAGAAGAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGGTCGGCCACGACCGCAGCAAGACCATCGATAACGACGAGACTGTGCATGTCAAACA
CGACCGCACCGAAACCGTCGATCACAACGAGACCATCACCATCGGCGTCAACCGCACCGAAAGCGTGGGC
AACAACGAGGACATCAGCATTGGCGTCAACCGTACCGAAAGCGTCGGCAGTAACGAGACGATCAGCATAG
GCCTCAACCGCACCATCAGCGTGGGCGCCAGCGAAACCGCGACCGTGGCCCTGCAACGCACCCATGCGGT
AGGTATCAACGAGACGATCGCCATCGGCGCCGCGCAGGAAGTTGTCATCGGTGCCTTTCAAACGGTGAAT
GTCGGGGCCTACCAAAACGTCAACGTGGGCCTCTACCAGTCGACCAATGTGGGCACCAACCGCTCGGTGG
ACGTCGGAGCCAATCTTTCAACGACGGTAAAAGACAACGAATCGCGCCAGGTCGGCGCAGGACGCACGAC
CGATATCGGCAAGGACGATGAGCTGACGGTGGGCAAGAACCTTGTCATCGATGCCGGTGACTCGGTGACC
ATCATGACCGGCAAAGCCAGCATCGTCATGAAGAAGGACGGCACCATCAGCATTAGCGGCAAGGACATCA
CCATAGACGGCTCTGGCGTGATCAACATCAAGGCTAACAAGAACGTGGTGATCAAGGGACGCAAGATCCT
GCAAAACTAG
 Primer design