SecReT6
Effector Protein ID: 501680512
SecReT6 ID764
T6SS typeA3
Gene symbol-
Locus tagPFLCHA0_c30640
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]3419539..3419994 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPFL_3037
DescriptionTge2
UniProt IDR4RK21
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Glucosaminidase [PF01832], Evalue: 2.30E-14, Aligned region: 20..141
Protein Sequence: 151 a.a.     [Download]
>gi|501680512|ref|YP_008000338.1| hypothetical protein PFLCHA0_c30640 [Pseudomonas protegens CHA0]
MSARLCNNISAVTFVSKYKAVCQPIADQLDLPVENLLGLAAQESQYGTGRIARELNNYFSMHAPAPLQIG
AEAPLGNASIKVAKFDSFQKSAQSFASSFGTAVRGQRDPMAFAQALVRSGYNTGNAKTGGRDGFARYLAD
IIIAVRGRMAC
-
Nucleotide Sequence: 456 bp     [Download]
>gi|501677485|ref|NC_021237.1|:c3419994-3419539 Pseudomonas protegens CHA0, complete genome
GTGAGCGCCAGACTCTGCAACAACATCAGTGCCGTGACCTTTGTCAGCAAGTACAAGGCGGTGTGCCAGC
CGATTGCCGACCAGCTGGACCTGCCGGTGGAAAACCTGCTGGGCCTGGCCGCCCAGGAAAGCCAGTACGG
CACCGGGCGCATTGCCCGGGAACTGAACAACTACTTTTCCATGCACGCACCGGCCCCCCTGCAGATCGGC
GCCGAGGCGCCCCTGGGCAACGCCAGCATCAAGGTGGCCAAGTTCGACTCCTTCCAGAAGTCCGCACAGT
CCTTTGCTTCGAGCTTTGGCACGGCAGTACGTGGCCAGCGTGACCCCATGGCATTCGCCCAGGCGCTGGT
ACGCAGCGGCTACAACACCGGCAACGCCAAGACCGGCGGCCGGGATGGCTTCGCCCGCTACCTGGCGGAC
ATCATCATCGCGGTCAGAGGGCGCATGGCGTGCTGA
 Primer design