SecReT6
Effector Protein ID: 501682868
SecReT6 ID764
T6SS typeA3
Gene symbol-
Locus tagPFLCHA0_c54520
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6071370..6071741 [+]
Productputative cytoplasmic protein
Effector typeProtein
Homologous effectorPFL_5498
DescriptionTae3
UniProt IDR4RD31
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.00016, Aligned region: 15..89
Protein Sequence: 123 a.a.     [Download]
>gi|501682868|ref|YP_008002694.1| putative cytoplasmic protein [Pseudomonas protegens CHA0]
MWNKEAAISHLNAHAHAGSTGRCAAYTRQAIEAGGGGVILHRKHSAKDFGSSLTSAGFIEQPAGQTPAAG
DVVIIQPIPGHPHGHMAMFNGTLWVSDFKQLHGFYPGHSYRVQKPAYKIYRHP
-
Nucleotide Sequence: 372 bp     [Download]
>gi|501677485|ref|NC_021237.1|:6071370-6071741 Pseudomonas protegens CHA0, complete genome
ATGTGGAATAAAGAAGCCGCTATCAGTCACTTGAACGCTCACGCTCACGCCGGTAGTACGGGGCGCTGTG
CGGCCTATACTCGCCAGGCGATCGAAGCCGGTGGCGGAGGGGTGATTCTGCACAGGAAGCATTCGGCCAA
GGACTTCGGCTCATCATTGACTTCTGCCGGTTTCATCGAACAACCGGCCGGCCAGACGCCCGCAGCGGGC
GATGTGGTGATCATCCAGCCCATTCCAGGGCACCCCCACGGTCACATGGCGATGTTCAACGGCACACTCT
GGGTGTCAGACTTCAAGCAACTGCACGGTTTCTACCCGGGGCATTCCTACCGGGTGCAGAAACCTGCCTA
CAAAATCTATCGCCATCCGTAA
 Primer design