SecReT6
Effector Protein ID: 501683454
SecReT6 ID764
T6SS typeA3
Gene symbolhcp
Locus tagPFLCHA0_c60480
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6709859..6710347 [+]
Productprotein Hcp
Effector typeProtein
Homologous effectorPA0085
DescriptionHcp protein
UniProt IDR4RHB5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-46, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|501683454|ref|YP_008003280.1| protein Hcp [Pseudomonas protegens CHA0]
MAVDIFIKIGDIKGESMDKAHKDEIDVLNWSWGMSQSGNMHVGGGGGAGKVNIQDLSLTKYVDKASPNLM
MHCSSGKHIDKVRLTVRKAGGESQVEYMIIDLEEVLITSLSTGGSGSDDRLTENITLNFAQVMVEYQPQK
ADGTKDGGPIKYGWNIRSNTKR
-
Nucleotide Sequence: 489 bp     [Download]
>gi|501677485|ref|NC_021237.1|:6709859-6710347 Pseudomonas protegens CHA0, complete genome
ATGGCTGTTGATATTTTCATCAAGATCGGTGACATCAAGGGCGAGTCCATGGACAAAGCCCACAAGGACG
AAATCGACGTGTTGAACTGGAGCTGGGGCATGTCCCAGTCCGGCAACATGCACGTTGGCGGTGGCGGCGG
CGCGGGCAAGGTGAACATCCAGGACCTGTCGCTGACCAAGTACGTGGACAAGGCATCGCCGAACCTGATG
ATGCATTGCTCCAGCGGCAAGCACATCGACAAGGTGCGCCTGACCGTGCGCAAGGCCGGCGGCGAAAGCC
AGGTCGAGTACATGATCATCGACCTGGAAGAAGTGCTGATCACTTCGCTGAGCACCGGCGGTTCGGGCAG
CGATGACCGCCTGACCGAAAACATCACCCTGAACTTCGCTCAGGTGATGGTCGAGTACCAGCCGCAGAAA
GCCGACGGCACCAAGGACGGCGGCCCGATCAAGTACGGCTGGAACATCCGCTCCAACACCAAGCGCTGA
 Primer design