SecReT6
Effector Protein ID: 501683459
SecReT6 ID764
T6SS typeA3
Gene symbol-
Locus tagPFLCHA0_c60530
StrainPseudomonas protegens CHA0
Repliconchromosome [GenBank: NC_021237] [Browse all T6SS(s) in this replicon]
Location [Strand]6716694..6718631 [+]
ProductRhs-family protein
Effector typeProtein
Homologous effectorPA0091
Descriptiontype VI secretion system Vgr family protein
UniProt IDR4RHC0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.00E-87, Aligned region: 30..329
Phage_base_V [PF04717], Evalue: 1.40E-25, Aligned region: 369..462
Protein Sequence: 645 a.a.     [Download]
>gi|501683459|ref|YP_008003285.1| Rhs-family protein [Pseudomonas protegens CHA0]
MLFQQSTRLAQVNCPLGPDVLLLKSLGGGEELGRLFDYQLQLASSDANIDLNQLLGKPMGLSVQLDGGGQ
RYFHGIVARCSQNIDTGQFASYEVTLRPWLWLLSRTSDCRIFQNLSIPQIIKQVFRDLGFSDFEDALSRP
YREWEYCVQYRETSFDFVSRLMEQEGIYYFFRHEKDRHVVVLADAYGAHSSVPGYASVPYYPRDEQQRER
DHMFDWHLAQEVQPGSLELNDYDFQRPSARIDVRSAMPRPHSAGDYPLYDYPGTYVQSSDGEHYAQTRIE
ALQSLHERIELSGNARGLGVGNLFSLTGFSRQDQNREYLIVSIRYYLVQESLESGAGGGSAQFESHLTCI
DAQQSFRPLATTHKPMVQGPQTARVVGPAGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPANATQSGMKSRSSKGGSPANFNEIRM
EDKKGAEQLYIHAERNQDIVVEVNESHSVGNNRNKSIGHDEYVTIGNKRTRIVQHVDELRVGEKKLDSVG
QSYVIEVGERLRLVCGASILELNASGQINLCGVNISVHASADAQINTGGVLHLNNGGGPGTTTEGQGVQG
AISAKAKAPFSAPKG
-
Nucleotide Sequence: 1938 bp     [Download]
>gi|501677485|ref|NC_021237.1|:6716694-6718631 Pseudomonas protegens CHA0, complete genome
ATGTTATTTCAGCAATCCACACGACTGGCACAGGTCAACTGCCCCCTGGGACCGGACGTCCTGCTGCTCA
AGAGCCTGGGCGGCGGCGAGGAGCTGGGGCGGCTGTTCGACTACCAGCTGCAACTGGCCTCCAGTGACGC
CAACATCGACCTCAACCAGTTGCTGGGCAAGCCCATGGGCCTCAGCGTACAGCTGGACGGCGGCGGCCAG
CGGTACTTCCACGGCATCGTCGCGCGCTGCAGCCAGAACATCGACACCGGCCAGTTCGCCAGCTACGAGG
TGACGCTGCGCCCCTGGCTGTGGCTGCTGAGTCGCACCTCCGACTGCCGGATTTTCCAGAACCTGAGCAT
CCCGCAGATCATCAAGCAGGTGTTCCGCGACCTGGGCTTTTCCGATTTCGAAGACGCCCTGAGCCGCCCC
TACCGGGAGTGGGAGTACTGCGTGCAGTACCGCGAGACCAGCTTCGATTTCGTCAGCCGGCTGATGGAAC
AGGAAGGTATCTACTACTTCTTCCGCCACGAGAAGGACCGCCACGTGGTGGTGCTGGCCGACGCCTATGG
CGCTCACAGCAGCGTGCCCGGCTACGCCTCGGTGCCCTACTACCCGCGAGACGAGCAGCAGCGCGAGCGC
GACCACATGTTCGACTGGCACCTGGCCCAGGAGGTGCAGCCCGGCTCGCTGGAGCTCAACGACTATGATT
TCCAGCGCCCCAGCGCCCGGATCGACGTGCGCTCGGCCATGCCGCGGCCCCACAGCGCCGGCGACTACCC
GCTCTACGACTACCCCGGCACCTACGTGCAGAGCAGCGACGGCGAGCACTATGCCCAGACCCGTATCGAG
GCCCTGCAAAGCCTGCATGAGCGCATCGAGCTCAGCGGCAACGCCCGGGGGTTGGGGGTGGGCAACCTGT
TCAGCCTCACCGGCTTCAGCCGCCAGGACCAGAACCGCGAATACCTGATCGTCAGCATCCGCTACTACCT
GGTCCAGGAAAGCCTGGAGAGCGGCGCTGGCGGCGGTTCGGCGCAGTTCGAGAGCCACCTGACCTGCATC
GACGCCCAGCAGAGCTTCCGCCCCCTGGCCACCACCCACAAGCCCATGGTCCAGGGCCCGCAGACCGCGC
GAGTGGTGGGCCCGGCCGGGGAAGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCACTTCCACTG
GGACCGCCACGACCAGTCCAACGAAAACAGCTCGTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGGAAG
AACTGGGGCTCGATGCAGATCCCGCGCATCGGCCAGGAAGTCATCGTCAGCTTCCTGGAAGGCGATCCCG
ATCGCCCGATCATCACCGGCCGGGTCTACAACGCCGAACAGACCGTGCCCTACGACCTGCCCGCCAACGC
CACCCAGAGCGGCATGAAGAGCCGTTCGAGCAAGGGCGGCAGCCCGGCCAACTTCAATGAAATCCGCATG
GAAGACAAAAAGGGCGCGGAGCAGCTGTACATCCACGCCGAGCGCAACCAGGACATCGTGGTCGAGGTCA
ACGAAAGCCATTCGGTGGGCAACAACCGCAACAAGAGCATCGGCCACGACGAGTACGTGACCATCGGCAA
CAAGCGCACGCGCATCGTTCAGCACGTGGATGAGCTGCGGGTCGGCGAGAAGAAGCTCGACAGCGTCGGC
CAGAGCTATGTGATCGAGGTCGGCGAGCGCCTGCGCCTGGTATGCGGGGCCAGCATCCTGGAGCTCAACG
CCAGCGGCCAGATCAACCTGTGCGGGGTCAACATCAGCGTGCATGCCTCGGCCGATGCCCAGATCAATAC
CGGTGGCGTGCTGCACCTGAACAACGGCGGCGGCCCGGGCACCACCACCGAGGGCCAGGGTGTGCAGGGC
GCCATCAGCGCCAAGGCCAAAGCCCCCTTTTCCGCCCCCAAAGGCTAA
 Primer design