SecReT6
Effector Protein ID: 512648107
SecReT6 ID809
T6SS typeA3
Gene symbol-
Locus tagH650_00800
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]29553..30035 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDR9VJS6
KEGG IDenr:H650_00800
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.50E-39, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|512648107|ref|YP_008106016.1| hypothetical protein H650_00800 [Enterobacter sp. R4-368]
MAIDMFLKVDGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAIL
KHCASGKHLTKVELSVCKAGGQQVEYARITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQSS
SGGKGAETTAGWNIKENKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|512647881|ref|NC_021500.1|:29553-30035 Enterobacter sp. R4-368, complete genome
ATGGCTATTGATATGTTTCTGAAGGTCGATGGAGTTACGGGTGAATCTAAAGACTCTAACCACACCGGCT
GGACTGATATCACATCTTTTTCCTGGGGTGCTTCACAACCTGGGAACATGAGCGTTGGCGGTGGCGGCGG
TGCCGGTAAAGTCAATTTTAATGACCTGCATGTTAACGCACTCATTGATAAATCCACGACGGCTATCCTG
AAACATTGCGCCAGCGGCAAACACTTGACCAAAGTTGAGCTGTCTGTCTGCAAAGCAGGCGGCCAGCAGG
TTGAGTATGCGCGCATCACGCTGGAAGACGTGCTGGTGACTTCCGTTCAGTACACCGGTGCTGACAACGG
CGACACCGTAGGTGTGACCTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGTCCTCC
TCCGGCGGTAAAGGTGCTGAAACCACCGCTGGCTGGAACATCAAAGAAAACAAAGAAGCGTAA
 Primer design