SecReT6
Effector Protein ID: 512648137
SecReT6 ID809
T6SS typeA3
Gene symbol-
Locus tagH650_00950
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]60162..64607 [+]
Producttype IV secretion protein Rhs
Effector typeProtein
Homologous effectorECL_01567
DescriptionrhsA
UniProt IDR9VJV2
KEGG IDenr:H650_00950
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 433..465
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 483..511
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 555..566
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 570..606
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 591..627
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 644..657
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 663..691
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 697..733
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 722..753
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 760..796
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 785..817
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 802..856
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 869..894
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 921..956
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 986..1009
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 1003..1042
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 1056..1087
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 1107..1136
RHS_repeat [PF05593], Evalue: 1.20E-53, Aligned region: 1151..1166
PAAR_motif [PF05488], Evalue: 5.90E-14, Aligned region: 3..17
PAAR_motif [PF05488], Evalue: 5.90E-14, Aligned region: 100..219
RHS [PF03527], Evalue: 4.00E-13, Aligned region: 737..753
RHS [PF03527], Evalue: 4.00E-13, Aligned region: 1117..1128
RHS [PF03527], Evalue: 4.00E-13, Aligned region: 1223..1260
RHS [PF03527], Evalue: 4.00E-13, Aligned region: 1348..1359
DUF4150 [PF13665], Evalue: 0.00019, Aligned region: 105..124
DUF4150 [PF13665], Evalue: 0.00019, Aligned region: 172..216
Rib_hydrolayse [PF02267], Evalue: 0.0046, Aligned region: 1348..1458
Protein Sequence: 1481 a.a.     [Download]
>gi|512648137|ref|YP_008106046.1| type IV secretion protein Rhs [Enterobacter sp. R4-368]
MSDKHAARQGDEIIHSSVFADITSIVAEGVAYAAIGSAVAFAAATAAPLLGAGAAAASVAAIGSSCLLSG
IVGGILANVAGITDDISNMANSLGDALFPPSPAGKIVTGSANVLTNNKLAARAAGTLTPADTPPAEPQSP
ASFADYAGMLLAGAKHFGSEMWQPTVGSADAGTSPLEQDKVACKKHSGPQYLAQGSKSVFINGQPAVRAK
DKTTCEGTVSDNVSPNVIIGGETLTVRDIKSGKLPGLAVAMIALSLIRGRPGKILKNMPCALASAGGGML
ADMAVNAIFGSPHPVHAATGVKVLNDEQELDFSLPGRFPLRLQRSYNSLTSRAGLFGAGWSTVFDSYLVL
TGDEACWFDETGRELRFTLPSVDHAMYSISEGVIIRRNDNGDVAIADDDGAVWRLFKPTRANPAILRLAS
LSDEYGNALETGWDEHGRLVRLHDAPCAIDVTFAYDDARFSQRVTSASHFDGEQHWPLMRWHYDARGQLA
TVTDASGIVTREYRYNDDGLMVWHRAAGGLESEYRWAMFDHWRVIENRTNTGDGCRFAYDLDAGLTTVTH
YDGQTRQHYWNTQGLIVRFVDERGENWRFEWNDNEQLTRRIDPLGNAMTFVYDEMGNRVQEIDADGNERA
TQWLENRALPAVITEPGGSTTRFFYDPHFGLARTVDALGQSTVWHRDEFGQVIEEVDAAGNSRRMEYNDA
GQVIRETDCSGHLTRYHYHPLGWLVAVQAADGEETRYHYDAAGRPVQLERAEGWLETLRWNEQGLPTEHE
AADGSRSAFRYDNTGRLVATRNHLGEEVRRSWDSRGRLVALHNENGEAYQFRWGADSLLLEEQGLDGVVS
RYTYDACGRTLSRTFAAGHPEAIIHRFSWSAAGQLLARSTPEVQTRWRWSAAGFPERISLHPALDENSWS
AEAEQELNFTFDALGRVIGEQGENGTLGWGYDALGNRTSLQLPDGRELKQFYYGSGHLLSIALDNLPISD
FGRDTLHREISRTQGLLTTRSDYDRLGRLHRRDVFSGNAQRPAPRRWSRRWDYDHRNNLVREERDDNPFN
WYRWKYDDAGRLLTQDGTLPGQEQWRWDAASNPVDTTVQHAVRHNRVTQLHGIRWQYDIHGRTVEKDNGQ
TRWRYRYDGEHRLTEVISQPRDRNKPQVQVSFRYDPLGRRISKTRRQMRAGQPVGQSVTTRFVWDGFRLL
QEIYDDVPLTYVYSDQGSFDPLARIDGITDPDVYWFHNQPNGTPERLTDVEGELRWEGQNSAWGKLLHET
PLRAPEYAQNLRMQGQYLDRETGLHYNLFRYYDPDCGRFTQQDPIGLAGGLNLYQYAPNAQGWVDPWGLS
SYDILMGQIERGELDFSTSKGGAVFWSGRNMKTAQEWARANGRTTLEQTSGGKYLDSLNLFESAKSGMSG
PQAAEIWDAASVKFAEQASGDVHVFGTGAKKMNDFGKVRTWWRIEKPILIANPNVNKVTRLKKNGLPAKT
GHIIKCKGDKG
-
Nucleotide Sequence: 4446 bp     [Download]
>gi|512647881|ref|NC_021500.1|:60162-64607 Enterobacter sp. R4-368, complete genome
ATGAGCGACAAACACGCGGCCCGTCAGGGCGATGAAATCATTCACTCGAGCGTTTTCGCCGATATCACCA
GTATCGTTGCCGAAGGGGTCGCTTATGCGGCGATTGGTTCGGCGGTGGCGTTCGCGGCGGCGACTGCAGC
GCCTTTATTGGGCGCCGGTGCTGCTGCCGCGAGTGTGGCGGCGATTGGTTCCAGTTGCCTGTTAAGCGGC
ATTGTTGGCGGCATCCTCGCTAACGTCGCCGGGATCACCGATGACATCAGTAATATGGCGAATAGCCTTG
GCGACGCGCTTTTCCCGCCGTCGCCCGCGGGTAAAATCGTTACCGGCTCGGCCAACGTATTGACCAATAA
TAAGCTCGCAGCGCGAGCGGCCGGAACCTTAACCCCGGCGGATACACCGCCTGCCGAGCCGCAATCGCCC
GCCAGTTTCGCCGATTACGCTGGCATGCTACTTGCCGGAGCAAAACATTTTGGCAGCGAAATGTGGCAGC
CGACCGTCGGCTCGGCGGACGCCGGGACATCGCCGCTGGAGCAGGACAAAGTGGCCTGCAAGAAGCACTC
CGGGCCGCAATATCTGGCCCAGGGGTCGAAAAGCGTGTTTATCAACGGCCAGCCAGCCGTACGCGCGAAA
GACAAAACCACCTGTGAAGGCACCGTTTCCGATAATGTCTCGCCGAATGTGATCATTGGCGGCGAAACCC
TGACGGTGCGCGATATCAAAAGTGGCAAATTGCCCGGTTTAGCGGTGGCGATGATCGCGTTGTCGCTTAT
CCGCGGACGCCCCGGCAAAATTTTAAAAAATATGCCCTGTGCGCTGGCGTCCGCAGGCGGCGGTATGTTA
GCGGACATGGCGGTGAATGCGATATTTGGCTCACCGCACCCGGTGCATGCCGCCACCGGTGTGAAAGTCC
TTAATGACGAGCAGGAACTTGATTTCTCACTGCCGGGGCGCTTTCCGCTGCGGTTGCAGCGCAGCTATAA
CAGCCTGACGTCACGCGCCGGGCTGTTTGGTGCGGGCTGGTCGACCGTTTTTGATAGTTATCTGGTGCTG
ACGGGGGATGAAGCCTGTTGGTTTGACGAAACCGGGCGTGAATTGCGTTTCACCTTGCCGTCGGTTGATC
ACGCTATGTACAGCATCAGTGAAGGGGTGATCATCCGGCGCAATGATAATGGCGATGTCGCCATTGCTGA
TGATGACGGCGCGGTATGGCGTTTATTCAAACCCACCCGCGCCAACCCGGCGATCCTGCGCCTTGCCTCG
CTCAGTGATGAATATGGCAACGCGCTGGAAACCGGCTGGGATGAGCACGGGCGTCTGGTACGGCTTCACG
ATGCGCCCTGCGCGATTGATGTGACGTTCGCTTATGATGACGCGCGTTTTTCGCAGCGTGTGACGTCCGC
CAGCCATTTTGATGGCGAACAGCACTGGCCGCTAATGCGCTGGCATTACGACGCGCGCGGTCAACTGGCA
ACGGTAACCGATGCCAGCGGGATCGTGACGCGCGAGTATCGTTATAACGATGACGGCCTTATGGTCTGGC
ACCGCGCCGCGGGCGGGCTGGAAAGCGAATACCGCTGGGCGATGTTTGATCACTGGCGCGTCATTGAAAA
CCGCACCAATACCGGAGACGGCTGCCGCTTTGCCTACGATCTCGATGCCGGGTTAACTACCGTTACGCAC
TATGACGGCCAGACGCGCCAGCACTACTGGAATACGCAGGGGTTGATTGTGCGCTTCGTCGATGAACGCG
GTGAAAACTGGCGTTTCGAATGGAACGACAACGAGCAATTAACCCGCCGTATCGATCCGCTCGGCAATGC
CATGACCTTCGTTTATGACGAGATGGGCAACCGGGTCCAGGAGATTGATGCCGACGGCAATGAACGCGCC
ACCCAGTGGCTGGAAAATCGCGCGTTGCCAGCGGTAATAACCGAACCCGGGGGCAGTACAACACGCTTTT
TTTACGACCCACATTTTGGCCTCGCGCGCACGGTGGACGCACTGGGGCAGAGCACCGTCTGGCATCGCGA
CGAGTTTGGTCAGGTTATCGAAGAGGTGGATGCGGCTGGCAATAGCCGTCGCATGGAGTACAACGATGCC
GGTCAGGTTATCCGCGAAACGGATTGTTCCGGGCATCTCACTCGTTATCACTACCATCCTCTCGGCTGGT
TGGTTGCGGTGCAGGCGGCGGACGGGGAAGAAACCCGTTACCACTATGATGCCGCAGGCCGCCCGGTGCA
GCTTGAGCGGGCAGAAGGCTGGCTGGAAACGCTGCGCTGGAACGAACAGGGGTTACCGACAGAACATGAA
GCGGCGGATGGCAGCCGCAGCGCGTTTCGTTATGACAACACCGGACGGCTGGTGGCGACGCGTAACCATC
TTGGGGAAGAGGTCCGCCGCAGTTGGGATAGCCGTGGCCGTCTGGTCGCCCTGCATAACGAGAACGGGGA
AGCCTACCAGTTCCGTTGGGGGGCGGATTCCCTGTTGCTGGAAGAGCAGGGGCTGGATGGTGTTGTCAGC
CGCTATACCTACGATGCCTGCGGACGCACGTTGTCGCGCACATTTGCCGCCGGGCACCCTGAGGCGATTA
TCCACCGTTTTAGCTGGAGCGCGGCTGGGCAGTTGCTCGCGCGATCCACACCGGAAGTCCAGACGCGCTG
GCGCTGGTCTGCTGCGGGATTTCCTGAACGCATTAGCCTGCATCCCGCGCTTGATGAAAACAGCTGGAGC
GCCGAAGCGGAGCAGGAGCTGAACTTCACTTTCGATGCGCTGGGACGCGTGATCGGCGAGCAGGGGGAAA
ACGGTACACTCGGCTGGGGCTACGATGCGCTGGGTAACCGCACCTCGCTACAGTTGCCGGATGGCCGTGA
GCTGAAACAGTTCTATTACGGCAGCGGGCATTTGTTAAGTATTGCGCTGGATAACCTGCCGATCAGTGAT
TTTGGCCGCGACACCTTGCACCGGGAAATTAGCCGCACACAAGGGCTGCTCACCACCCGCAGTGATTATG
ATCGCCTTGGGCGCCTGCATCGGCGAGACGTCTTTAGCGGCAACGCGCAGCGTCCGGCGCCGCGACGCTG
GTCCCGCCGCTGGGATTACGATCATCGCAATAATCTGGTGCGCGAAGAGCGGGACGATAATCCGTTTAAC
TGGTATCGCTGGAAATACGACGATGCCGGGCGCTTGCTGACGCAGGACGGTACTCTGCCGGGGCAGGAGC
AGTGGCGCTGGGATGCGGCGAGCAACCCTGTCGATACAACGGTGCAGCATGCCGTGCGCCACAACCGCGT
CACGCAGTTGCATGGTATCCGCTGGCAATATGACATCCACGGTCGCACCGTGGAGAAAGATAACGGCCAG
ACGCGCTGGCGCTATCGCTATGATGGCGAACACCGGCTGACGGAGGTCATCAGCCAGCCGCGTGACCGCA
ATAAGCCGCAGGTGCAGGTCAGTTTTCGTTATGACCCGTTGGGACGACGCATCAGCAAAACACGCCGCCA
GATGCGCGCTGGCCAGCCGGTCGGGCAAAGCGTTACCACGCGTTTCGTCTGGGACGGTTTCAGGTTATTA
CAGGAAATTTACGACGATGTGCCGCTGACCTATGTTTACAGCGATCAGGGCAGCTTCGACCCGCTGGCGC
GCATCGACGGTATTACCGACCCGGACGTTTACTGGTTTCACAATCAGCCAAATGGCACACCGGAGCGTCT
CACCGACGTGGAAGGTGAGTTGCGTTGGGAAGGGCAGAATAGCGCGTGGGGTAAACTGCTGCATGAAACA
CCGCTGCGCGCACCTGAATATGCCCAGAACCTGCGCATGCAGGGACAGTACCTGGATCGCGAAACCGGCT
TACACTACAATCTGTTCCGCTATTACGACCCCGACTGCGGGCGCTTTACCCAGCAGGACCCGATAGGGCT
GGCGGGTGGGCTCAATCTTTACCAGTATGCGCCGAATGCGCAGGGATGGGTGGATCCGTGGGGGTTGAGT
TCATATGACATACTGATGGGACAAATTGAACGTGGCGAACTTGATTTCTCAACTTCGAAAGGCGGTGCTG
TTTTCTGGTCAGGACGCAATATGAAAACCGCACAGGAGTGGGCGCGAGCTAATGGCCGAACCACGCTCGA
GCAAACGTCTGGTGGTAAATATCTGGACAGCCTGAATCTGTTTGAAAGTGCAAAATCAGGAATGTCAGGT
CCTCAGGCTGCTGAAATTTGGGATGCCGCATCTGTAAAATTTGCCGAGCAGGCATCAGGAGATGTTCATG
TTTTTGGTACAGGAGCCAAGAAAATGAACGATTTTGGAAAGGTACGAACGTGGTGGCGTATTGAAAAACC
GATATTAATAGCAAATCCCAACGTAAACAAAGTTACACGACTGAAAAAAAATGGCTTGCCAGCGAAAACT
GGCCACATAATAAAATGTAAAGGAGATAAAGGGTGA
 Primer design