SecReT6
Effector Protein ID: 512650062
SecReT6 ID810
T6SS typeA2
Gene symbol-
Locus tagH650_11235
StrainEnterobacter sp. R4-368
Repliconchromosome [GenBank: NC_021500] [Browse all T6SS(s) in this replicon]
Location [Strand]2206448..2206939 [-]
ProductHcp family type VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDR9VQB0
KEGG IDenr:H650_11235
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.50E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|512650062|ref|YP_008108062.1| Hcp family type VI secretion system effector [Enterobacter sp. R4-368]
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQQHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTTLENVKVVKVNPVMHDIKDPSYEKHNHLEQIELRYE
KITWTYKDGNIIHSDSWNERATA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|512647881|ref|NC_021500.1|:c2206939-2206448 Enterobacter sp. R4-368, complete genome
ATGGCAATTCCCGTTTACCTTTGGCTGAAAGATGACGGCGGCGCGGACATTAAAGGGTCTGTGGATGTCC
AGGATCGCGAAGGCAGCATCGAAGTCGTTGCACAGCAGCACAACCTGTACATCCCGACGGACAACAACAC
CGGCAAGCTGACCGGTACCCGTATCCACACCCCGTTCCTGTTTACGAAGGAAATCGATTCTTCCAGCCCG
TATCTGTACAAGGCGGTGACGACCGGCCAGACCCTGAAGTCTGCTGAATTCAAGTGGTACAAAATCAACG
ACGCGGGTCAGGAAGTGGAGTACTTCAACACCACTCTGGAAAACGTGAAAGTGGTGAAAGTGAATCCGGT
GATGCACGACATCAAAGATCCTTCTTACGAGAAGCACAACCACCTCGAACAGATCGAACTGCGCTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATCATTCATTCCGATTCCTGGAACGAACGCGCCACCGCGT
AA
 Primer design