SecReT6
Effector Protein ID: 514412207
SecReT6 ID814
T6SS typeA4a
Gene symbol-
Locus tagM062_26790
StrainPseudomonas aeruginosa RP73
Repliconchromosome [GenBank: NC_021577] [Browse all T6SS(s) in this replicon]
Location [Strand]5796270..5798507 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA5089
DescriptionPldB
UniProt IDR9ZK82
KEGG IDprp:M062_26790
PDB IDNA
Domain hit(s) vs Pfam PLDc [PF00614], Evalue: 1.10E-06, Aligned region: 303..329
PLDc [PF00614], Evalue: 1.10E-06, Aligned region: 640..661
PLDc_2 [PF13091], Evalue: 1.60E-06, Aligned region: 56..117
PLDc_2 [PF13091], Evalue: 1.60E-06, Aligned region: 281..332
PLDc_2 [PF13091], Evalue: 1.60E-06, Aligned region: 433..466
PLDc_2 [PF13091], Evalue: 1.60E-06, Aligned region: 635..687
Protein Sequence: 745 a.a.     [Download]
>gi|514412207|ref|YP_008135735.1| hypothetical protein M062_26790 [Pseudomonas aeruginosa RP73]
MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEAARHSIDIITW
GFDPAMRFKRPDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGAGVGGSGGTWAGSGVASGSAV
DNEVLRLEQRRQHNLNLIARQQEALERSERLHREGRLPSFDPRGAAHARARIAELEAENAEIQRTLDSSE
ARGYGGKRGSGGTRQDPWGQIFTRDWFKAVRGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIH
LLRADGIDDLGIGQLLVLTQFASHHQKMVLVDYGSPQAIGFVMGHNMHRNYWDTSAHLFDDRAAGRDPGF
GPWQDISMQVQGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALPLPKIATPASNSVAQICRTQP
QDDERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVTNTPDSSDASK
TTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQENNIERLERKIEALEEKGVT
PEVEQRLGDFGAQEIPGLAKNTGEDDKPYQLVEVPGLKVVVATLATSDPVPGSPPPARLSAEAEAALGAP
PLKARYKHIYVHSKLLLVDDLYTLLSSANINVRSMHGDSELGIAQPNPDLARAMREELWGAHAYEVAKTI
EDNFELWSQKMDDNWKAQVADEPFTSHLLRFWDVTTPYSPNLTVD
-
Nucleotide Sequence: 2238 bp     [Download]
>gi|514407635|ref|NC_021577.1|:c5798507-5796270 Pseudomonas aeruginosa RP73, complete genome
ATGAGCGACCTGTACAAACCGCAGACCCTCAAGCTGTACGCGCAACAGGCCGGCAGCGTCCGGCTGACCC
TCGACTGGTTCGCCAACAAGGCTTTCTACCCGCCGCGCGCGGGTGTGCACATCAAGCCGCTGATCAATGG
CCAGGCGGCCTTCGACGCGGTGCATGCGGCGATGGAAGCGGCCCGGCACAGCATCGACATCATCACCTGG
GGCTTCGACCCGGCCATGCGCTTCAAACGCCCCGACGGACCGCGAATCGGCGAATTGCTGCAGACGAAGG
GCCGCGAAGGAGTGCAGGCGCGAGTGCTGGTCTGGAGCAACCAACTCGCCAGGCTCAAGGAAAACACCAT
CCCCGGGGCCGGCGTCGGCGGTTCCGGCGGCACCTGGGCGGGCTCGGGCGTCGCCAGCGGCAGCGCGGTG
GACAACGAGGTGCTGCGACTGGAGCAGCGGCGCCAGCATAACCTCAACCTCATCGCGCGGCAGCAGGAAG
CCCTGGAACGCTCGGAACGGCTGCACCGCGAAGGCAGGCTGCCGAGCTTCGACCCGCGGGGCGCCGCCCA
CGCGCGGGCGCGCATCGCCGAGCTGGAGGCGGAGAACGCCGAGATCCAGCGCACTCTCGACAGCAGCGAG
GCCCGGGGCTACGGCGGCAAGCGCGGTTCCGGCGGCACCCGCCAGGATCCCTGGGGGCAGATATTCACCC
GCGACTGGTTCAAGGCGGTACGCGGCGGTGGGTTGCAGAACGTCGAGTTCCGTACCCGCGACTTCGAGCA
GACGGCCAGGCCGGTGATGAACGGCGAGCAGGTGCGCCTCGTCAATGGGCGACTGCAAAGCCTGATCCAC
CTGCTGCGCGCCGATGGCATCGACGACCTGGGCATCGGCCAGTTGCTGGTACTCACCCAGTTCGCCAGCC
ATCACCAGAAGATGGTCCTGGTCGACTATGGCAGCCCGCAGGCCATCGGCTTCGTCATGGGTCACAACAT
GCACCGCAACTACTGGGACACCAGCGCCCACCTGTTCGACGACCGCGCCGCCGGTCGCGATCCCGGGTTC
GGGCCCTGGCAGGATATCTCCATGCAGGTCCAGGGACCGGTGCTGGCCGACCTCAGCCGCAACTTCAGCG
AGGCCTGGGACCTCGAGACGCCGTGGTACAAGCGCTGGTTCTCGACGCCATCGCTGACCGCCGAGCGCGA
CGCCTTGCCGCTGCCGAAGATCGCCACGCCCGCCAGCAACAGCGTCGCGCAGATTTGCCGGACCCAGCCG
CAGGACGACGAGCGCTCGATCCTGGAGCACTATCTCAAGGCCCTGGGCAATGCCACCGACTACGTCTACA
TGGAAAACCAGTACTTCCGTTATGCCGGCTTCGCCGAGCGCCTGCGGAAGACTGCGCAGGTGCGCAAGGC
CCGGGGCGTGCCCGGCGACCTGTACCTGTTCGTCGTGACCAACACCCCCGACTCCAGCGACGCCTCGAAG
ACCACCTACGACATGATGAAAGGCCTGGGCCAGGAGCAACTGATGCCGCAGGTACAGCGCGACCTGGCGC
ATGACTTGCGGGAAAAGCGGGAGCAGTTGAAGCAGGTCAGGGAAAACCTACATCCCGATCCCTATGTCCG
GCGCGGCCAGGAAAACAACATCGAACGGCTGGAGCGCAAGATCGAGGCGCTCGAAGAGAAAGGCGTGACG
CCGGAAGTCGAGCAACGCCTCGGCGATTTCGGCGCGCAGGAGATTCCCGGACTGGCGAAGAACACCGGCG
AGGACGACAAGCCCTATCAACTCGTCGAAGTACCCGGCCTCAAGGTGGTCGTCGCCACCCTGGCCACCAG
CGACCCCGTCCCCGGCAGCCCGCCGCCAGCGCGCCTGTCCGCCGAAGCCGAGGCCGCCCTCGGGGCGCCG
CCGCTGAAGGCGCGCTACAAGCACATCTACGTGCACTCCAAGCTGCTGCTGGTGGATGACCTCTATACCC
TGCTCAGCTCGGCCAATATCAATGTCCGCAGCATGCATGGCGACAGCGAGTTGGGGATTGCCCAGCCCAA
TCCGGATTTGGCGAGGGCGATGCGGGAGGAGTTGTGGGGGGCACATGCTTATGAAGTTGCCAAAACGATC
GAAGACAACTTCGAACTGTGGAGTCAGAAGATGGATGATAACTGGAAGGCCCAAGTGGCAGATGAGCCTT
TTACCTCGCACTTGCTGCGTTTCTGGGATGTCACCACGCCCTATAGTCCCAATCTTACGGTGGACTGA
 Primer design