SecReT6
Effector Protein ID: 525958502
SecReT6 ID827
T6SS typeA1
Gene symbol-
Locus tagM636_14870
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1406602..1407120 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorVP1393
DescriptionHcp protein
UniProt IDS5JBI7
KEGG IDvpk:M636_14870
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|525958502|ref|YP_008316323.1| hypothetical protein M636_14870 [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MPTPAYMSINGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPLVV
TKVQDRSSPLLFNALVSGEKLPECLIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVT
EEVLKFTYRAIEVTHENCGTAGNDDWRAPREA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1407120-1406602 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGCCAACTCCAGCATATATGTCTATCAACGGTGAAACTCAAGGTCACATTACTAAAGATACATACTCTG
CAGATTCAGTAGGTAACACATGGCAAGAAGCTCACGTTGATGAGTTCCTAGTACAAGAACTTGATCACGT
GCTAACTGTTCCACGTGATCCACAAAGTGGTCAACCTACTGGTCAACGTGTACACCGTCCACTTGTTGTG
ACTAAAGTTCAAGACCGTTCTTCTCCACTACTATTTAACGCATTAGTGTCTGGTGAAAAACTTCCTGAGT
GTTTGATTCGTTTCTACCGTACTTCAGTTCAAGGCAAGCAAGAGCACTACTACTCAATCAAGCTGATTGA
TGCGCTATTGGTAGATATCCAAACTCGTATGAACCACTGTCAAGATGCAGCAACAGCTGATCGCGTTACA
GAAGAAGTTCTTAAGTTTACTTACCGTGCAATCGAAGTAACTCACGAAAACTGTGGTACAGCTGGTAACG
ACGACTGGCGTGCTCCACGCGAAGCATAA
 Primer design