SecReT6
Effector Protein ID: 525958505
SecReT6 ID827
T6SS typeA1
Gene symbol-
Locus tagM636_14895
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1418027..1419697 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorVP1388
DescriptionVP1388
UniProt IDS5J7J5
KEGG IDvpk:M636_14895
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 556 a.a.     [Download]
>gi|525958505|ref|YP_008316328.1| hypothetical protein M636_14895 [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MWRIQMHLVCKFIPSSKLSSNELSYVLTPDECIGQLSRVRNSEDILRNLPKELAQKISISAKKSSSGLLT
AIRHELGNGNWVALSSFSRRTPLTDTQLQSFPRLKAQLESVSSTGESKVYKAGYKQVKDDVTLVRSYTHV
PSEPSPDQKIVVEFAGQWSSNAACLMLGKTEAQKEKVTVGKADTENKHRSLATFKDLEAEGKTLYIKIPC
SDQPQPILLKLAQELQPVDKETQMDEWDNVLVPVRPLAYLDGSNDKAKASDLRGGFLYVFWKGKLWREMA
INEKGYYQDVDVEYYRTLEQEEKKKDTPQVIQRSASGFAMAHFWAPYKISGEVQQGENGLKIIFSPKQKR
FAQIEALESDAALLEKSSTPLDELSSYSDAQSFSAKEFTSDVDSAAIHKVTEDDMPWLSDQQAIVRSYDQ
SNTVIAYVDGKNSGLLFRVDVGTSGITALNSLYVIDHNSDYKDVFDLEFYEGEDHDWQQALLSGLPLDGV
FTMSLVHDQDPDSRHILFDRVAYNDLFVEPESATETPPKALPNDKPKGMTTEEKQRFESLVLDWSL
-
Nucleotide Sequence: 1671 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1419697-1418027 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
TTGTGGAGAATTCAAATGCATTTAGTTTGCAAATTTATACCTAGCTCGAAGCTTTCCTCCAACGAGCTAT
CCTACGTCCTTACACCTGATGAGTGTATAGGACAGCTTTCGCGTGTGCGAAATTCAGAAGACATTCTCAG
AAACCTTCCTAAAGAGCTTGCTCAGAAGATCTCAATCTCTGCCAAGAAGTCTAGCTCCGGGTTGCTAACG
GCTATTCGACACGAGCTAGGAAATGGGAACTGGGTTGCGTTGTCTTCTTTCTCTCGTAGAACGCCGTTAA
CAGATACCCAATTACAAAGTTTCCCAAGACTAAAAGCACAGCTTGAATCGGTCTCATCGACTGGTGAGAG
CAAAGTTTATAAAGCGGGTTATAAGCAGGTAAAGGACGACGTGACTTTGGTTCGTAGCTACACGCATGTC
CCTTCTGAGCCAAGTCCAGACCAAAAAATCGTTGTCGAGTTTGCAGGGCAGTGGTCTAGCAATGCAGCAT
GTTTGATGTTGGGTAAAACCGAAGCTCAAAAAGAAAAAGTGACTGTAGGCAAAGCTGATACAGAAAATAA
ACACCGCAGCCTCGCGACGTTTAAAGATCTCGAAGCTGAGGGCAAAACGCTCTATATCAAAATCCCTTGT
TCTGACCAGCCTCAGCCGATCTTGCTTAAACTTGCCCAAGAGCTGCAACCCGTTGATAAAGAGACGCAGA
TGGATGAGTGGGATAACGTGTTGGTGCCGGTGAGACCTTTGGCTTACTTAGATGGTAGCAACGACAAAGC
AAAAGCTTCTGACCTGCGTGGTGGTTTCCTTTATGTGTTTTGGAAAGGAAAGCTTTGGCGAGAGATGGCG
ATAAACGAGAAAGGTTACTACCAAGATGTTGACGTCGAGTATTACCGCACGCTAGAGCAAGAAGAAAAGA
AAAAAGACACACCTCAGGTAATACAAAGAAGCGCAAGCGGTTTTGCTATGGCGCATTTCTGGGCACCTTA
CAAAATATCGGGTGAAGTCCAACAGGGAGAAAATGGACTCAAGATCATTTTCTCACCAAAGCAAAAGCGC
TTTGCTCAAATTGAAGCATTAGAATCAGATGCTGCTTTGCTTGAGAAATCCAGCACACCATTAGATGAAT
TAAGCAGTTACAGTGACGCACAGTCATTCAGTGCAAAAGAATTCACCTCCGATGTAGACAGCGCGGCCAT
CCACAAAGTTACCGAAGACGACATGCCATGGCTGAGTGATCAACAAGCCATCGTTCGGAGTTACGACCAG
AGTAATACGGTCATTGCTTATGTGGATGGAAAAAACAGTGGCCTATTATTCCGAGTGGATGTTGGTACGT
CTGGCATCACCGCTTTGAATTCACTCTATGTGATCGATCACAATAGCGATTATAAAGACGTCTTTGATTT
AGAGTTTTATGAAGGGGAAGACCACGATTGGCAGCAAGCGTTATTAAGCGGGCTGCCATTGGACGGGGTC
TTTACTATGTCCCTGGTACATGACCAAGACCCAGACAGTCGTCACATACTTTTTGATCGGGTCGCTTACA
ACGATTTATTTGTTGAACCTGAGAGCGCTACTGAAACTCCGCCAAAAGCTCTGCCAAACGACAAGCCTAA
AGGTATGACTACAGAAGAGAAACAACGCTTTGAGTCATTAGTGCTGGATTGGTCGTTGTAA
 Primer design