SecReT6
Effector Protein ID: 525960171
SecReT6 ID827
T6SS typeA1
Gene symbol-
Locus tagM636_14765
StrainVibrio parahaemolyticus O1:K33 str. CDC_K4557
Repliconchromosome I [GenBank: NC_021848] [Browse all T6SS(s) in this replicon]
Location [Strand]1378773..1380929 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorVP1415
DescriptionVP1415
UniProt IDS5JY56
KEGG IDvpk:M636_14765
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 2.40E-36, Aligned region: 19..128
DUF4150 [PF13665], Evalue: 2.40E-36, Aligned region: 157..188
DUF4150 [PF13665], Evalue: 2.40E-36, Aligned region: 446..478
AHH [PF14412], Evalue: 9.00E-09, Aligned region: 543..628
Protein Sequence: 718 a.a.     [Download]
>gi|525960171|ref|YP_008316302.1| hypothetical protein M636_14765 [Vibrio parahaemolyticus O1:K33 str. CDC_K4557]
MGVTVGANGLSIVHKGSGGEANATLPDVCLTKVGKPIVPIPYGNNAKSADLAGGTTTISMDGGNSVAIKG
STFSKSTGDAGGDKKGVASGTIEAEAKFISASPTVKFEGKGVCRLSDQMTMNKANTMCLGGAQNPSVSVT
EADDGTFTIDIDYRYPDGDPVYKADFKIIDSTGTEHVGTLSDKGKGTITGLPAGSISLFLGEDKRDIEPI
QKPQPNKDYLELPGPLDLVEFAGRGLVEYWDAVEMPSDYSQWAWGAIMGDFNQDRSAGQIAFDSAVTAIP
FIDQIGDGRDISANLYAFYNTDDIREDKEKYTDLVITLVGFIPTAGSLIKGLFKELKILGKAADLDMIAA
FLRAGAKGDVVKWMQSLDMSVIKNDIYGQLDDITKQVKTLMDTLEQESRKRGYTVVADAYKRCVEQLDDF
FKKADGPISKVLSDFDDRLKMLLPEAPLVTSGTSFSISAGTAQGGGKAEVIKTRNKTKKKTDTCPLCNKK
IGKGKKECEGAKVGSISKAVMDDGSSQKLWKEFEIRNGWRDKTEHPWWHGAGAVQAHHLIPKNAFKLKNA
KSKQTKEKMMFLRRIAQTCAYNIDFWKNGIGLPNKKETACFLRKPRHAGGHDRNEFNYTNECVKLVHDKL
SSDIKKRTKEGSCSKTTNSSLIMKFNESSKNIFDNIADFIWFITRDGKNYDPKVEPYVGCSSNCKKIHPI
ININTKRQIENYDLEIGK
-
Nucleotide Sequence: 2157 bp     [Download]
>gi|525957490|ref|NC_021848.1|:c1380929-1378773 Vibrio parahaemolyticus O1:K33 str. CDC_K4557 chromosome I, complete sequence
ATGGGCGTAACAGTTGGTGCAAATGGACTTTCGATAGTTCATAAAGGCTCAGGTGGTGAAGCGAATGCAA
CGCTCCCAGATGTTTGTTTAACGAAGGTCGGTAAGCCGATCGTTCCTATCCCTTATGGCAACAATGCCAA
ATCAGCAGATCTTGCTGGTGGCACTACGACTATCTCTATGGATGGTGGCAACAGTGTCGCAATTAAAGGC
AGTACGTTTTCAAAAAGTACCGGTGATGCGGGCGGCGATAAAAAAGGCGTCGCATCCGGCACGATAGAAG
CCGAAGCAAAATTCATTTCAGCCTCACCAACGGTTAAGTTTGAAGGTAAGGGCGTATGTCGCCTGTCCGA
TCAAATGACCATGAACAAAGCCAACACCATGTGTCTCGGTGGCGCACAAAATCCATCGGTTTCTGTTACG
GAAGCAGATGATGGAACATTTACCATAGACATTGATTATCGATACCCAGATGGAGACCCAGTATACAAAG
CCGATTTCAAGATTATTGACAGTACTGGTACAGAACATGTTGGCACTTTAAGCGACAAAGGTAAGGGGAC
GATTACGGGCTTACCAGCAGGTTCTATCAGTTTATTCCTGGGTGAGGATAAGAGAGATATAGAGCCAATC
CAAAAGCCGCAACCAAACAAGGATTATCTTGAACTGCCGGGGCCTTTGGACTTAGTAGAGTTTGCTGGAC
GTGGCTTGGTTGAATATTGGGATGCTGTTGAAATGCCGAGTGATTATAGTCAATGGGCTTGGGGAGCGAT
CATGGGGGACTTCAATCAAGATCGATCTGCTGGCCAAATTGCTTTTGATAGTGCTGTTACAGCTATACCA
TTCATCGATCAAATTGGGGACGGTCGAGACATTAGTGCCAACCTTTATGCTTTTTATAATACAGACGACA
TAAGAGAAGATAAAGAAAAGTACACAGATCTCGTTATCACTCTAGTTGGCTTTATTCCCACCGCAGGTAG
CTTGATAAAAGGGTTATTTAAGGAACTTAAAATCTTGGGCAAAGCCGCTGATTTAGATATGATTGCTGCT
TTCCTTAGAGCCGGAGCAAAAGGTGATGTGGTCAAATGGATGCAAAGCCTTGATATGTCCGTCATCAAAA
ATGATATATATGGTCAACTAGATGATATTACTAAACAAGTAAAAACGTTAATGGATACACTTGAGCAAGA
GAGCCGTAAAAGAGGGTATACTGTTGTTGCTGACGCCTATAAAAGGTGTGTGGAACAGCTAGATGACTTT
TTTAAGAAAGCTGACGGACCAATATCTAAAGTCTTAAGCGATTTTGATGATAGGCTCAAGATGCTCCTGC
CTGAGGCACCTTTAGTTACATCAGGGACTTCCTTTAGCATTTCTGCAGGGACGGCTCAAGGAGGAGGCAA
AGCTGAGGTAATTAAGACTCGTAATAAGACGAAAAAGAAGACTGATACGTGTCCGTTGTGTAATAAAAAG
ATTGGAAAAGGGAAGAAAGAGTGCGAAGGGGCGAAAGTCGGTAGTATCAGCAAAGCAGTTATGGACGATG
GTTCCTCTCAAAAATTATGGAAAGAATTCGAAATACGAAATGGTTGGCGAGACAAGACAGAGCACCCTTG
GTGGCACGGGGCGGGAGCAGTGCAGGCTCACCATCTTATTCCTAAAAATGCATTCAAACTAAAAAATGCA
AAGAGTAAGCAAACTAAAGAAAAAATGATGTTTCTTAGACGAATTGCTCAGACGTGCGCTTACAACATCG
ACTTTTGGAAAAATGGTATTGGCCTTCCTAATAAGAAAGAAACAGCGTGTTTTTTGAGGAAACCTCGACA
TGCAGGCGGTCACGATCGTAATGAATTTAACTACACGAACGAATGTGTAAAGCTTGTTCATGACAAGTTA
AGCTCAGATATCAAGAAAAGAACAAAAGAAGGTAGTTGTTCCAAGACAACAAACTCTTCGTTGATTATGA
AGTTCAATGAATCAAGCAAAAATATTTTTGATAATATTGCTGACTTTATCTGGTTTATTACTCGTGATGG
AAAAAACTATGATCCTAAAGTAGAACCTTACGTGGGCTGTAGTTCAAATTGCAAAAAAATACACCCGATT
ATTAATATAAACACTAAGCGACAAATTGAAAACTATGACTTAGAGATTGGAAAATAA
 Primer design