SecReT6
Effector Protein ID: 526228441
SecReT6 ID828
T6SS typeA4a
Gene symbol-
Locus tagA464_2489
StrainSalmonella bongori N268-08
Repliconchromosome [GenBank: NC_021870] [Browse all T6SS(s) in this replicon]
Location [Strand]2469996..2470313 [+]
ProductPutative cytoplasmic protein
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDS5MYJ5
KEGG IDsbz:A464_2489
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.0036, Aligned region: 15..88
Protein Sequence: 105 a.a.     [Download]
>gi|526228441|ref|YP_008323084.1| Putative cytoplasmic protein [Salmonella bongori N268-08]
MSRDKRTAINYAKAHAGSHSQGRCAEFTRKAIQADGITLGHTWHDKDYGLMLRSAGFTAIGIYETPHEGD
VIIIQPYAGGNPSGHMAIYDGYGLEKRVLFSGAKK
-
Nucleotide Sequence: 318 bp     [Download]
>gi|526225953|ref|NC_021870.1|:2469996-2470313 Salmonella bongori N268-08, complete genome
ATGAGCCGGGACAAAAGGACGGCCATTAATTATGCCAAAGCACATGCGGGCTCACATTCTCAAGGACGGT
GTGCGGAGTTCACCCGAAAAGCAATTCAGGCGGACGGTATCACGCTGGGGCATACCTGGCATGACAAAGA
TTATGGCCTCATGTTAAGAAGCGCCGGATTCACCGCTATTGGCATCTATGAAACGCCGCACGAGGGAGAT
GTGATCATTATTCAACCTTACGCTGGTGGAAACCCGAGCGGTCACATGGCGATATACGATGGTTACGGGT
TGGAAAAGCGCGTCCTGTTCTCGGGGGCGAAAAAGTAG
 Primer design