SecReT6
Effector Protein ID: 528829165
SecReT6 ID836
T6SS typeA5
Gene symbolrbsB-2
Locus tagREMIM1_CH02415
StrainRhizobium etli bv. mimosae str. Mim
Repliconplasmid pRetMIM1f [GenBank: NC_021905] [Browse all T6SS(s) in this replicon]
Location [Strand]2405399..2406328 [+]
Productribose ABC transporter substrate-binding protein RbsB 2
Effector typeProtein
Homologous effectorRbsB
DescriptionRbsB
UniProt IDS5SJD8
KEGG IDrel:REMIM1_CH02415
PDB IDNA
Domain hit(s) vs Pfam Peripla_BP_4 [PF13407], Evalue: 1.20E-53, Aligned region: 30..283
Peripla_BP_1 [PF00532], Evalue: 7.00E-17, Aligned region: 28..278
Peripla_BP_6 [PF13458], Evalue: 3.70E-12, Aligned region: 54..260
Peripla_BP_3 [PF13377], Evalue: 3.90E-07, Aligned region: 34..88
Peripla_BP_3 [PF13377], Evalue: 3.90E-07, Aligned region: 152..296
DUF917 [PF06032], Evalue: 0.0014, Aligned region: 70..115
DUF917 [PF06032], Evalue: 0.0014, Aligned region: 180..201
DUF3798 [PF12683], Evalue: 0.0045, Aligned region: 42..65
DUF3798 [PF12683], Evalue: 0.0045, Aligned region: 165..279
Protein Sequence: 309 a.a.     [Download]
>gi|528829165|ref|YP_008365121.1| ribose ABC transporter substrate-binding protein RbsB 2 [Rhizobium etli bv. mimosae str. Mim1]
MKIARTMLASAALLGLMLGPVHAAELKKLGLAVANLQANFFNQIKQSVEAEAKKRGIEVITVDAKGDGPT
QVNQIQDLLTQKIDALIYIPAGAAAATVPVKLAKNAGIPVVNVDRNAEGAPGDTFLATDSVASAKAVCDY
ILKEAGGKGKMVIIHGQKGTTPEVDRSKGCGESLKAYPDVKVVAEQYSNIWSQDEGFQIMQNMLQANPDV
SIVFAQADGLALGAAQAIKVANPSQKIVVGGFDGDTAALEALSKGVFNVTATQQTQKMGRDAVENAAKLV
AGGKVPPVQLLDATLTTKENVAGFIANHP
-
Nucleotide Sequence: 930 bp     [Download]
>gi|528826861|ref|NC_021905.1|:2405399-2406328 Rhizobium etli bv. mimosae str. Mim1, complete genome
ATGAAAATTGCGCGCACCATGCTCGCGTCCGCTGCACTGCTCGGTCTCATGCTCGGTCCCGTTCACGCGG
CGGAACTGAAAAAGCTTGGTCTGGCCGTTGCCAACCTTCAGGCAAACTTCTTCAACCAGATCAAGCAATC
GGTCGAAGCCGAAGCCAAGAAGCGCGGCATCGAGGTTATCACGGTCGACGCGAAGGGCGACGGGCCGACG
CAGGTCAACCAGATCCAGGATCTTCTGACCCAGAAAATCGATGCACTGATCTACATTCCGGCAGGTGCCG
CCGCGGCAACCGTTCCGGTCAAACTCGCGAAGAACGCCGGCATTCCCGTCGTCAACGTCGATCGCAACGC
CGAAGGCGCGCCGGGCGATACATTCCTCGCAACCGATTCCGTCGCGTCTGCCAAGGCGGTGTGCGACTAC
ATCCTGAAGGAAGCCGGCGGCAAGGGGAAGATGGTCATCATCCATGGCCAGAAAGGCACGACGCCGGAAG
TCGATCGCTCGAAGGGCTGCGGCGAATCCCTCAAGGCCTATCCTGATGTGAAGGTCGTTGCCGAACAATA
TTCGAACATCTGGAGCCAGGACGAGGGCTTCCAGATCATGCAGAATATGCTGCAGGCTAATCCTGATGTC
TCGATCGTCTTCGCCCAGGCCGATGGTCTCGCGCTTGGCGCCGCTCAGGCAATCAAGGTCGCAAATCCCT
CGCAGAAGATCGTAGTCGGCGGCTTCGATGGCGACACTGCGGCTCTCGAAGCGCTCAGCAAGGGCGTCTT
CAACGTGACGGCGACCCAGCAGACCCAGAAAATGGGACGCGATGCGGTTGAAAACGCCGCCAAGCTCGTC
GCCGGTGGAAAGGTACCCCCGGTACAGCTCTTGGATGCCACGCTGACAACCAAGGAAAACGTCGCGGGCT
TCATCGCCAACCACCCGTAA
 Primer design