SecReT6
Effector Protein ID: 53719658
SecReT6 ID77
T6SS typeA4b
Gene symbol-
Locus tagBPSL2046
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]2443535..2446870 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2697
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ63TC2
KEGG IDbps:BPSL2046
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.70E-51, Aligned region: 35..340
Phage_GPD [PF05954], Evalue: 6.70E-51, Aligned region: 668..770
DUF2345 [PF10106], Evalue: 1.60E-48, Aligned region: 588..636
DUF2345 [PF10106], Evalue: 1.60E-48, Aligned region: 667..820
T6SS_Vgr [PF13296], Evalue: 8.30E-31, Aligned region: 516..623
T6SS_Vgr [PF13296], Evalue: 8.30E-31, Aligned region: 693..720
Phage_base_V [PF04717], Evalue: 3.40E-15, Aligned region: 384..497
Phage_base_V [PF04717], Evalue: 3.40E-15, Aligned region: 576..589
Protein Sequence: 1111 a.a.     [Download]
>gi|53719658|ref|YP_108644.1| hypothetical protein BPSL2046 [Burkholderia pseudomallei K96243]
MDLVAALTGYSQTTRHIRIDTAMPGAFVVERFHGREGVNESFRFEIDVLSSEPFLDLTPLIGHAARLRLA
TGAGERSWNGYVTHAAYADSDGEITRYRLTMESWLALLRLRRNCLYFVDVDTKDICERVFGDYPQARWRY
ELKEPLRKFSLRGQYRETDDTFVLRQLAEAGLSFRIEHAQDAGKEASGDHTIVVFDRRAPFRHGSTIAYN
LQDVGDPDGVITQFSERHQMVPDRVVATSWKADELLALAGHAQQPPEDKAPVLPVREIYDGQRAGRFDTI
DDAQRFAEQRLDALRLPKRIHYGAGSSRTLEIGAVHTLAGYLDRAITFVPLSIEHEAVNNLGADIGALLG
RGELDKGLYRNRFVAVPDGTPIVPPHRDRPIVHGVQTAIVVGEAGSRVSSTRDHQVRVQFPWMRGTAPLP
GGLTDTASRSNPAGHAPGDHRSGVLARVAESSAGPNFGHAFTPRVGAEVVIGFESGNIDMPVVLGQVYGG
RVQPPFAAGEGSDANHPGTLTGLQTQTLDGQSGSRWVMDDAAGQLRHELSNSTANSRLAQGYLIDQQGAM
RGAYRGEGFELATDGWGVVRAGEGVLVSSTARRLATSTQMDVAQSVGQLKQAVRTAQGMSESAAAAHAGG
LAANAAQADFLKAIDPAQDGKYTGAVNGQSATKASGAQRDGGEPVEHFAAPAVLMESPENIVLTTPHSAV
SYAAQHVHLTAQRDAHVAAAATVAAASGDAVSLYAAAGGLRAIASDGPVSVEAHTSTMEILADQSVRITS
TDDRIDVLAKDAIVLQQGPNRITLKGGDITVETPGQFLVKSGAHPFPGPAAQSVSLPPLPIPAPLALFDE
QIRFVNEDGEPLGNVAYQLKLADGSTVSGVTDDNGRTERVSTDGPTAIQSATLTPTQVVDCCGRTSDVPP
PAVKVDIKGVGTHDTLVGSSEQSVTVKGESRPLTDGEIEMAKTVFQDSIDYSAVRVHKGSYFWFNLQSKR
TAVTPNNTMYFREEDFVEDFSVVSEEYPRRGWFMHEMTHVWQHQRGYAVRWHALTVTIRGESAYRYEIEP
GQVFSDFNMEQQGNLVSDYFALIVVDNRGELIHAQPGSKNQLRQVLAPLLQDPKDASNLPK
-
Nucleotide Sequence: 3336 bp     [Download]
>gi|53717639|ref|NC_006350.1|:c2446870-2443535 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
ATGGATTTAGTCGCCGCATTGACGGGCTATTCTCAAACGACTCGCCACATCCGGATCGACACGGCGATGC
CGGGCGCGTTCGTGGTCGAACGTTTCCATGGGCGCGAGGGCGTCAACGAATCGTTTCGCTTCGAGATCGA
CGTGCTATCGAGCGAGCCGTTTCTCGATCTGACGCCACTCATCGGCCACGCGGCGCGGCTGCGTCTCGCG
ACGGGCGCGGGCGAGCGCAGCTGGAACGGCTATGTGACGCATGCGGCGTATGCGGACAGCGACGGCGAGA
TCACCCGCTATCGCCTCACGATGGAGTCGTGGCTCGCGCTGTTGCGCCTGCGTCGCAATTGCCTGTACTT
CGTCGACGTCGACACGAAGGACATCTGCGAGCGCGTGTTCGGCGATTATCCGCAAGCGCGTTGGCGCTAC
GAACTGAAGGAACCGCTGCGCAAGTTCAGCCTGCGCGGCCAGTACCGGGAGACCGACGACACGTTCGTGC
TGCGCCAGCTCGCCGAAGCCGGCCTGTCGTTCAGGATCGAGCATGCGCAGGATGCGGGCAAGGAAGCGTC
GGGCGACCATACGATCGTCGTGTTCGATCGGCGCGCGCCATTTCGGCACGGCAGCACGATCGCATACAAC
CTGCAGGACGTCGGCGATCCGGACGGCGTGATCACGCAGTTTTCCGAACGCCATCAGATGGTGCCGGACC
GGGTCGTCGCGACGAGCTGGAAAGCCGACGAATTGCTCGCGCTCGCCGGGCACGCGCAGCAGCCGCCCGA
GGACAAGGCGCCGGTGCTGCCCGTGCGCGAAATCTACGACGGCCAACGCGCGGGCCGCTTCGACACGATC
GACGACGCGCAGCGCTTCGCCGAGCAGCGGCTCGACGCGCTGCGCCTGCCGAAGCGGATCCATTACGGCG
CGGGCTCGTCGCGCACGCTCGAGATCGGCGCGGTCCATACGCTCGCCGGTTATCTGGACCGTGCGATCAC
GTTCGTGCCGCTGTCGATCGAGCACGAGGCGGTCAACAATCTCGGCGCCGACATCGGCGCGCTGCTCGGG
CGCGGCGAGCTCGACAAGGGGCTGTACCGCAACCGTTTCGTCGCGGTGCCCGACGGCACGCCGATCGTGC
CGCCGCATCGCGATCGGCCGATCGTGCACGGCGTGCAGACCGCGATCGTCGTCGGCGAGGCCGGCAGCCG
CGTCAGCAGCACGCGCGATCATCAGGTGCGCGTGCAGTTTCCGTGGATGCGCGGCACGGCGCCGCTGCCC
GGCGGCCTGACCGACACGGCGAGCCGCTCGAATCCGGCCGGGCACGCGCCGGGCGATCATCGCTCGGGCG
TGCTCGCGCGCGTCGCGGAATCATCGGCCGGGCCGAACTTCGGGCATGCGTTCACGCCGCGCGTCGGCGC
CGAAGTGGTGATCGGCTTCGAGTCGGGCAACATCGACATGCCCGTCGTGCTCGGCCAGGTCTACGGCGGG
CGCGTGCAGCCGCCGTTCGCGGCGGGCGAAGGCAGCGACGCGAACCATCCGGGCACGCTGACCGGCCTGC
AGACGCAAACGCTCGATGGCCAGTCCGGCAGCCGCTGGGTAATGGACGACGCCGCGGGACAACTGCGGCA
CGAGCTGAGCAACTCGACCGCGAACAGCCGGCTCGCGCAGGGTTACCTGATCGATCAGCAGGGCGCGATG
CGCGGCGCGTATCGCGGCGAAGGCTTCGAGCTCGCGACCGACGGTTGGGGCGTCGTGCGCGCGGGCGAAG
GCGTGCTCGTATCGAGCACGGCGCGGCGGCTCGCGACGTCGACGCAGATGGACGTCGCGCAAAGCGTCGG
ACAACTGAAGCAGGCGGTGCGGACCGCGCAGGGCATGAGCGAATCCGCCGCCGCGGCGCACGCGGGCGGG
TTGGCCGCCAATGCCGCGCAGGCGGATTTCCTGAAGGCGATCGATCCGGCGCAGGACGGCAAGTACACGG
GCGCGGTCAACGGGCAGAGCGCGACGAAGGCGAGCGGCGCGCAGCGCGACGGCGGGGAGCCGGTCGAGCA
CTTCGCCGCGCCGGCGGTGCTGATGGAGTCGCCGGAGAACATCGTGCTGACGACGCCGCACAGCGCCGTC
TCGTATGCGGCGCAGCACGTGCATTTGACCGCGCAGCGCGACGCGCACGTAGCGGCCGCCGCGACGGTCG
CGGCCGCGTCGGGCGATGCCGTGAGCCTGTATGCCGCCGCGGGCGGCCTCCGGGCGATCGCGAGCGACGG
GCCGGTGAGCGTCGAGGCGCATACGTCGACGATGGAGATTCTCGCGGATCAGTCGGTGCGCATCACGTCG
ACCGACGATCGCATCGACGTGCTCGCGAAGGACGCGATCGTGCTGCAGCAGGGGCCGAACCGGATCACGC
TGAAGGGCGGCGACATCACGGTCGAGACGCCGGGGCAGTTCCTCGTGAAGTCGGGCGCGCATCCGTTTCC
GGGGCCGGCCGCGCAGAGCGTTTCACTGCCGCCGCTGCCGATTCCCGCGCCGCTCGCGCTGTTCGACGAA
CAGATTCGCTTCGTCAACGAAGACGGCGAGCCGCTCGGCAACGTCGCGTACCAGCTGAAGCTCGCCGATG
GCTCGACCGTGTCGGGCGTGACCGACGACAACGGCAGAACCGAGCGCGTATCGACGGACGGGCCGACGGC
GATCCAGTCGGCGACGCTCACGCCGACGCAGGTCGTCGACTGCTGCGGGCGAACCTCGGATGTGCCGCCG
CCGGCGGTGAAGGTCGACATCAAGGGCGTCGGCACCCACGACACGCTGGTGGGCAGCTCGGAGCAATCGG
TCACGGTCAAGGGCGAGAGCCGGCCGCTGACCGACGGTGAGATCGAGATGGCGAAAACCGTGTTTCAGGA
CAGCATCGATTACAGCGCGGTGCGCGTGCACAAGGGCAGCTATTTCTGGTTCAACTTGCAGAGCAAGCGT
ACGGCCGTGACGCCGAACAACACGATGTATTTCCGCGAAGAGGATTTCGTGGAGGATTTTTCGGTTGTCA
GCGAGGAGTATCCGAGGCGGGGTTGGTTCATGCACGAAATGACGCACGTTTGGCAACATCAACGAGGATA
TGCCGTGCGCTGGCATGCGCTTACCGTGACGATTCGCGGCGAGAGCGCGTATCGGTACGAAATCGAGCCC
GGGCAAGTCTTCAGCGATTTCAATATGGAGCAGCAAGGCAATCTTGTATCAGACTACTTTGCGCTCATTG
TCGTGGACAATCGAGGTGAGTTGATTCATGCGCAACCAGGAAGCAAGAATCAACTTCGCCAAGTGCTGGC
TCCACTTCTACAGGATCCCAAGGATGCATCGAATCTTCCGAAATAG
 Primer design