SecReT6
Effector Protein ID: 53719659
SecReT6 ID77
T6SS typeA4b
Gene symbol-
Locus tagBPSL2047
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]2446979..2449387 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2698
DescriptionTle1
UniProt IDQ63TC1
KEGG IDbps:BPSL2047
PDB IDNA
Domain hit(s) vs Pfam DUF2235 [PF09994], Evalue: 3.40E-55, Aligned region: 42..137
DUF2235 [PF09994], Evalue: 3.40E-55, Aligned region: 260..281
DUF2235 [PF09994], Evalue: 3.40E-55, Aligned region: 285..409
Protein Sequence: 802 a.a.     [Download]
>gi|53719659|ref|YP_108645.1| hypothetical protein BPSL2047 [Burkholderia pseudomallei K96243]
MSYRFASADRFDVNVVTKDEQDAILRRLHEDDGMACCKTLHIGIFFDGTRNNADRDRGARTESNVARLYA
AFPIDKYHQAIYVAGVGTPFVEQIGDFGVGLQAAAGAAAGWAGEGRINWALLRIHDILHAYVHGQTLTAV
LGKRYEELVKSMSLDMNFKGIDLGGTPPKPGSFGDIKLRANSGVGALKLIAAEQNGVELTWDLDTNWAQL
KNELDSSKWNAAVQEWDAKRRKVLLDRRAQLKARIGDLLVKGKPKLQRIRLYVFGFSRGAAEARTFSNWL
ADALDPDFSLCGVPVSYDFLGIFDTVASVGIAQSAAATLFDGHGGWGRKELMAVPHYVRRCVHMVAAHEP
RGSFPLDLIDCSMDGREEIVYPGVHSDVGGGYGPGEQGRGRDDADKLSQVPLLDMYREARKAGVPLDING
PGIGADVIAAFKVSAGLKQAFAAYVKKSENYYYEKDHGTPGLMRCHYGLYLRWRKMRLKDMHAQPSFKAA
QARYPQDAADLDSANAELKEEWNDLLEVEKAGGPTITRYVEKFVTKWASENPKTAAVVSTSLLPAAVAAE
VFVPGVSAATVLFGDKVVKLVQAQLKEKWEQWLQVRSDWNMGPPEPAISALYDNYMHDSRAWFKPLGDDD
DVWNHRQIQELKTKQASFERAHAAWKKRVEMGMPSLLQVTQAMGVGSTGWGPVGGLPPEPEPRSPLTAQQ
ADLLKRYDAAMQSAKQARAAKDPNAPTDSAVLTDPKVTGGLALQTSGREFYFLWGFLRWRTVFVNGVRWD
QPRVPTVQEEMEGMRMQMQRQVDMKGIGVLFQ
-
Nucleotide Sequence: 2409 bp     [Download]
>gi|53717639|ref|NC_006350.1|:c2449387-2446979 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
ATGAGTTATCGTTTCGCATCCGCCGACCGATTTGATGTTAATGTCGTTACGAAAGACGAGCAGGACGCTA
TTTTGCGGAGGCTGCATGAAGATGACGGCATGGCTTGTTGTAAGACATTGCATATCGGAATCTTCTTTGA
TGGTACGCGTAACAACGCTGATCGGGATAGGGGGGCGCGAACGGAAAGCAATGTGGCACGGCTTTATGCC
GCTTTTCCAATAGATAAATATCACCAAGCGATTTACGTTGCTGGAGTTGGCACGCCTTTTGTCGAGCAGA
TTGGTGATTTCGGTGTTGGCTTACAGGCGGCCGCAGGAGCTGCGGCAGGTTGGGCGGGAGAGGGGCGAAT
TAACTGGGCTTTGCTTCGGATTCACGATATTTTGCATGCGTATGTTCACGGTCAGACGTTAACGGCAGTG
TTAGGAAAGCGCTACGAGGAACTCGTAAAATCGATGAGCCTCGATATGAATTTTAAGGGCATCGACCTTG
GCGGAACGCCGCCTAAACCGGGAAGCTTCGGCGATATCAAATTGCGTGCCAATTCTGGTGTGGGGGCGCT
CAAGCTGATTGCTGCCGAACAGAATGGTGTCGAGCTGACTTGGGATTTAGATACGAATTGGGCGCAGCTC
AAAAACGAGTTGGATTCGTCGAAGTGGAATGCAGCCGTGCAAGAATGGGACGCCAAGCGCCGTAAGGTAT
TGCTCGATCGTCGTGCTCAGCTAAAAGCGCGCATCGGTGATCTGCTGGTCAAGGGGAAGCCGAAGCTGCA
ACGCATTCGGCTATACGTATTCGGCTTTTCGCGCGGTGCAGCGGAGGCTCGCACTTTCTCGAACTGGCTT
GCTGACGCGCTTGACCCCGATTTCAGTTTGTGTGGAGTGCCGGTTTCATACGATTTTCTCGGTATCTTTG
ATACGGTCGCATCGGTCGGCATCGCTCAGAGCGCCGCCGCAACATTATTCGACGGACATGGAGGATGGGG
GCGCAAGGAACTGATGGCCGTGCCGCATTATGTGCGCCGTTGCGTGCACATGGTGGCGGCACATGAACCT
CGTGGATCATTTCCGCTCGACCTTATCGATTGTTCGATGGACGGTCGTGAGGAGATTGTCTACCCGGGTG
TTCACTCGGACGTCGGCGGCGGCTATGGGCCGGGCGAACAGGGGCGCGGTCGGGACGACGCCGACAAACT
TTCGCAAGTCCCGCTGCTTGATATGTACCGGGAGGCGCGTAAGGCAGGTGTGCCCTTGGATATCAATGGG
CCAGGTATCGGCGCGGACGTCATCGCTGCATTCAAGGTTTCAGCAGGGCTAAAACAAGCCTTCGCAGCCT
ACGTAAAAAAGAGCGAGAACTATTATTACGAGAAAGATCACGGCACGCCGGGCCTAATGCGTTGCCATTA
CGGCTTGTATCTCCGGTGGCGCAAGATGCGGCTCAAGGACATGCATGCACAGCCCAGCTTCAAGGCTGCG
CAGGCGCGCTATCCGCAAGATGCAGCGGATCTGGACAGTGCGAACGCGGAATTGAAGGAGGAGTGGAACG
ATTTGCTGGAGGTCGAGAAAGCTGGCGGCCCGACAATCACCCGATACGTGGAGAAGTTTGTTACGAAATG
GGCCAGTGAGAATCCGAAAACGGCCGCCGTCGTTTCCACGTCTCTACTTCCGGCCGCGGTCGCTGCTGAG
GTTTTTGTTCCGGGGGTTAGCGCTGCGACGGTTCTATTCGGCGACAAAGTGGTGAAACTGGTGCAAGCCC
AACTCAAGGAGAAGTGGGAGCAGTGGCTGCAAGTTCGCAGCGACTGGAACATGGGGCCGCCTGAACCTGC
GATCAGCGCACTCTACGACAACTACATGCACGACTCCCGCGCATGGTTCAAGCCGCTCGGCGACGATGAC
GACGTGTGGAACCATAGGCAGATTCAGGAACTCAAGACCAAGCAAGCCAGCTTTGAACGCGCCCATGCTG
CCTGGAAAAAGCGTGTCGAAATGGGCATGCCAAGCTTGTTGCAGGTTACACAGGCAATGGGCGTAGGTTC
CACAGGATGGGGGCCCGTCGGCGGGCTTCCGCCCGAACCCGAACCCCGCTCCCCGCTCACCGCCCAGCAA
GCCGATCTGCTCAAGCGCTACGACGCCGCGATGCAGTCCGCCAAGCAGGCACGCGCCGCAAAGGACCCGA
ACGCGCCGACGGACAGCGCCGTGCTGACCGATCCGAAGGTGACGGGCGGCCTCGCGCTGCAAACCAGCGG
CCGCGAGTTCTATTTCCTGTGGGGCTTCCTGCGCTGGCGGACCGTGTTCGTGAACGGCGTGCGCTGGGAC
CAGCCGCGCGTGCCGACGGTGCAGGAGGAAATGGAGGGCATGCGCATGCAGATGCAGCGCCAGGTCGACA
TGAAGGGCATCGGCGTACTGTTCCAATGA
 Primer design