SecReT6
Effector Protein ID: 53719663
SecReT6 ID77
T6SS typeA4b
Gene symbol-
Locus tagBPSL2050
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]2451504..2454302 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2705
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ63TB7
KEGG IDbps:BPSL2050
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.90E-46, Aligned region: 37..356
DUF2345 [PF10106], Evalue: 1.20E-44, Aligned region: 742..900
T6SS_Vgr [PF13296], Evalue: 4.60E-31, Aligned region: 579..687
Phage_base_V [PF04717], Evalue: 1.90E-18, Aligned region: 158..184
Phage_base_V [PF04717], Evalue: 1.90E-18, Aligned region: 423..520
Protein Sequence: 932 a.a.     [Download]
>gi|53719663|ref|YP_108649.1| hypothetical protein BPSL2050 [Burkholderia pseudomallei K96243]
MSVITQFTSLFSAANCLYCLDGPGEIASLQIERWVGRETLSENFQWDVYALATDPGLDLDAMLGQRVTIR
TALANGTSAVRSGLVAQAECIGYDAGLARYCLQLVPWLAALAHGRDERTFVRQGVADVLGAVFAPYGAIA
RWRFTADANQRIAELGARDYRVQYRTHTHFDFVRHVLAEAGLGFCFVEEADAPAGHTMLIFDDSTQLPED
ETSARMGGVPQRLSGTATEPDDVIVGIGRSLSLTADRVTLISSDYRGNQSTSATASLGNPAGSRELYDDV
GPEAFDSLREADAAARRHADAIVSAARFWTGYGTLRTARAGRALRIAGATWRMSRGGAPAPDAFVLTRVD
QIGINNLPATVMERVERSLGPLPPANLDARVLAQAKAGGYANRFDAAPRDQAWRPTLEDGTGQRLNPVPT
ALGAQTAIVVGPQGETRPGSTGPVHTDAQGRLRLRYHWQADGDAGTYPTRAMQRLASEGHGLQQTPRIGH
EVLVQFVNGLVHRPIVLGGLFNGRGEGGEAPTPGGEAGQPLDESVYAQASDHAASAQGNLAGGHSPAWHG
AGGGAKRHDHAGALSGFKSQGFDGQGYNQLVADDTDRMGRMQMATTHAATQLNIGHLRHQADNYLGSFRG
QGVELRSDAYGALRGARGVLISSYAPTGPSQPAGDASALQSLLAQQAGLAKLLDKSADTHKTLPFAAQRG
AQRAGQSSMNGDAAPLDALGKSFATTVGADGYAQASADASRRATGNALPHTGDAVLGVEAKGGQGLLAGQ
SLQWAAGETLTIGSGNDTNLAVNRTLRVHSGQGIGWLAGANGAQGVGMSVIAGKDDLALQAQHDLMALRA
RDDLRVASIGADVEIAAKQTVRLAVSGGAHLTIEGGNVTFGCPGSLVVHAAQHTFVGPDQLAPALPQFPE
KVCVECLKHAMQSGSALAGKAI
-
Nucleotide Sequence: 2799 bp     [Download]
>gi|53717639|ref|NC_006350.1|:c2454302-2451504 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
ATGAGCGTGATCACGCAATTCACGTCGCTTTTCAGCGCTGCCAATTGTCTCTATTGTCTCGACGGTCCGG
GCGAAATCGCGTCGCTGCAGATCGAGCGCTGGGTGGGGCGGGAGACGCTCTCCGAGAACTTCCAGTGGGA
TGTCTACGCGCTCGCGACCGATCCCGGCCTCGACCTCGACGCGATGCTCGGGCAGCGCGTGACGATCCGC
ACGGCGCTCGCGAACGGCACGAGCGCCGTGCGCAGCGGGCTCGTGGCGCAGGCCGAGTGCATCGGCTACG
ACGCCGGCCTCGCGCGCTACTGCCTGCAGCTCGTGCCGTGGCTCGCCGCGCTCGCGCACGGCCGCGACGA
GCGCACGTTCGTGCGGCAGGGCGTCGCCGACGTGCTCGGCGCGGTGTTCGCGCCGTACGGCGCGATCGCC
CGCTGGCGCTTCACCGCGGACGCGAACCAGCGCATCGCGGAACTCGGCGCGCGCGACTACCGCGTGCAGT
ACCGCACCCACACGCATTTCGATTTCGTCCGGCACGTGCTTGCCGAAGCGGGTCTCGGCTTTTGCTTCGT
CGAGGAGGCGGACGCGCCCGCGGGCCACACGATGCTGATCTTCGACGACAGCACGCAGTTGCCCGAGGAC
GAGACTTCCGCGCGCATGGGCGGCGTGCCGCAGCGGCTGAGCGGCACGGCGACCGAGCCGGACGACGTGA
TCGTCGGCATCGGGCGGTCGCTGTCGCTGACCGCGGATCGCGTCACGCTGATCAGCAGCGACTACCGCGG
CAACCAGTCGACGAGCGCGACGGCGAGCCTCGGCAATCCGGCCGGATCGCGCGAGCTGTACGACGACGTC
GGGCCGGAGGCGTTCGACAGCCTGCGCGAGGCCGACGCCGCCGCGCGGCGGCACGCGGACGCGATCGTCT
CGGCGGCGCGCTTCTGGACAGGCTACGGCACGTTGCGCACCGCGCGCGCCGGCCGCGCGCTGCGCATCGC
GGGCGCGACGTGGCGCATGTCGCGCGGCGGCGCGCCGGCGCCCGATGCGTTCGTGTTGACGCGCGTCGAT
CAGATCGGCATCAACAATTTGCCCGCGACGGTGATGGAGCGCGTCGAGCGCAGCCTCGGCCCGCTGCCGC
CCGCGAATCTCGACGCGCGCGTGCTCGCGCAGGCGAAGGCGGGCGGCTATGCGAACCGGTTCGACGCCGC
GCCGCGCGACCAGGCATGGCGCCCGACGCTGGAGGACGGCACCGGCCAGCGACTGAACCCGGTGCCGACG
GCGCTCGGCGCGCAGACGGCGATCGTCGTCGGGCCGCAGGGCGAGACGCGGCCGGGCTCGACGGGCCCGG
TGCATACCGACGCGCAGGGCCGGTTGCGGCTGCGCTATCACTGGCAGGCGGACGGCGACGCGGGCACCTA
TCCGACGCGCGCGATGCAGCGGCTCGCGAGCGAGGGGCACGGGCTGCAGCAGACGCCGCGGATCGGCCAC
GAAGTGCTGGTGCAGTTCGTCAACGGCCTCGTGCACCGGCCGATCGTGCTCGGCGGGCTGTTCAACGGCC
GCGGCGAGGGCGGCGAAGCGCCGACGCCCGGCGGCGAAGCGGGGCAGCCGCTCGACGAATCGGTCTACGC
ACAGGCGAGCGACCACGCGGCGAGCGCGCAGGGCAATCTTGCGGGCGGCCATAGCCCCGCGTGGCACGGC
GCGGGCGGCGGCGCGAAGCGCCACGATCACGCGGGCGCGCTGTCCGGCTTCAAGAGCCAGGGGTTCGACG
GCCAGGGCTACAACCAGCTCGTCGCGGACGATACCGATCGCATGGGCCGCATGCAGATGGCGACGACGCA
CGCGGCGACCCAGCTCAACATCGGCCACTTGCGGCATCAGGCCGACAACTATCTCGGCAGCTTCCGCGGG
CAAGGCGTCGAGCTGCGCTCGGACGCGTACGGCGCGCTGCGCGGCGCGCGCGGCGTGCTGATCTCCAGCT
ATGCGCCGACGGGGCCGTCGCAGCCGGCGGGCGATGCGTCGGCGCTGCAGTCGCTGCTCGCGCAACAGGC
GGGGCTCGCGAAGCTTCTCGACAAATCGGCGGACACGCACAAGACCTTGCCGTTCGCCGCGCAGCGTGGC
GCGCAGCGGGCCGGACAGTCGTCGATGAACGGCGACGCCGCGCCGCTCGACGCGCTCGGGAAGAGTTTCG
CGACGACGGTCGGCGCCGACGGCTACGCGCAGGCGTCGGCCGACGCATCGCGCCGCGCGACGGGCAATGC
GCTGCCGCATACCGGCGACGCGGTGCTCGGCGTCGAGGCGAAGGGCGGCCAGGGGCTGCTGGCCGGCCAG
TCGCTGCAATGGGCGGCGGGCGAGACGCTGACCATCGGCAGCGGCAACGACACCAACCTCGCGGTCAACC
GGACGTTGCGCGTGCACAGCGGGCAGGGCATCGGCTGGCTTGCCGGCGCGAACGGCGCGCAGGGCGTCGG
CATGAGCGTGATCGCCGGCAAGGACGATCTGGCGCTGCAGGCGCAGCACGACCTGATGGCGCTGCGCGCG
CGCGACGATCTGAGGGTCGCGTCGATCGGCGCGGACGTCGAGATCGCGGCGAAGCAGACCGTGCGGCTCG
CGGTCAGCGGCGGCGCGCATCTGACGATCGAAGGCGGCAACGTCACGTTCGGCTGCCCGGGCTCGCTCGT
CGTTCATGCGGCCCAGCATACGTTCGTCGGGCCGGATCAACTGGCTCCCGCGCTGCCGCAGTTTCCCGAG
AAGGTGTGCGTCGAATGCCTGAAGCACGCGATGCAATCGGGCAGCGCACTGGCCGGCAAGGCGATCTGA
 Primer design