SecReT6
Effector Protein ID: 53720714
SecReT6 ID77
T6SS typeA4b
Gene symbol-
Locus tagBPSL3105
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]3710641..3711144 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDQ63QB8
KEGG IDbps:BPSL3105
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.40E-45, Aligned region: 6..139
Protein Sequence: 167 a.a.     [Download]
>gi|53720714|ref|YP_109700.1| hypothetical protein BPSL3105 [Burkholderia pseudomallei K96243]
MLHMHLKFGSPAIKGESADKDHEGWIELKSWDHSIVQPRSATASTAGGHTATRCEHGDMVFTKEIDSSSP
LLYQHASGGTTFDEVTIDFLRADGEGQRVKYLEIKLKYVIISSIAPSVHTEGLPVETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|53717639|ref|NC_006350.1|:c3711144-3710641 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
ATGTTACACATGCATTTGAAGTTCGGTAGTCCCGCCATCAAGGGCGAGTCCGCCGACAAGGACCACGAAG
GCTGGATCGAGCTGAAATCCTGGGATCACTCGATCGTTCAGCCGCGTTCGGCGACCGCGTCGACGGCGGG
CGGCCACACGGCGACGCGTTGCGAGCACGGCGACATGGTGTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTATCAGCACGCGTCGGGCGGCACCACGTTCGACGAAGTGACGATCGATTTCCTGCGCGCGGACG
GCGAAGGCCAGCGCGTGAAGTATCTCGAGATCAAGCTGAAGTACGTGATCATCTCGAGCATCGCGCCGAG
CGTGCATACCGAAGGCCTGCCGGTCGAGACCTTCTCGCTGAAGTACGCCGCGGTCCAGTGGAAGCAGACG
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGCCTCACGAAGAACGACAAGA
CCTACGCGGTCTAA
 Primer design