SecReT6
Effector Protein ID: 53721116
SecReT6 ID77
T6SS typeA4b
Gene symbol-
Locus tagBPSS0078
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]88921..91692 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I3225
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ63P68
KEGG IDbps:BPSS0078
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.50E-58, Aligned region: 44..375
DUF2345 [PF10106], Evalue: 2.70E-42, Aligned region: 611..643
DUF2345 [PF10106], Evalue: 2.70E-42, Aligned region: 695..846
T6SS_Vgr [PF13296], Evalue: 3.10E-39, Aligned region: 560..668
T6SS_Vgr [PF13296], Evalue: 3.10E-39, Aligned region: 735..800
Phage_base_V [PF04717], Evalue: 9.60E-19, Aligned region: 459..543
Protein Sequence: 923 a.a.     [Download]
>gi|53721116|ref|YP_110101.1| unnamed protein product [Burkholderia pseudomallei K96243]
MNDTLRNFASGAVDWNKRPVALHFGAAQAALGHLLALQHASVQEGLMTGIHGRLTCVSTRRDLPPGVLLG
IPVSIRLITDRGQPHTVNAIISDVQIGQSDGELCVYQLTVCDALSLMDKRTNSRVFRKRSVIDVLATLFN
EWQQRSPALARAFEFDLSGLRADRYPPRELTRQVNESDAHFVRRLLRREGITVFAKAGPAKGERPLQGDA
PVHTLVCCDDPMSLPQAPAGTVRLHPRDGGAAQRDTVTLFALRRQLAPGKAGRPSWDYKKARIDESSVAS
SLDQGEAGNDLAKLLTDIAIDIAHAGDSWRDHERLTRARMLAHEFEAERHDGVSSVRDLAVGTWITLTGD
PQWDRQRADKRQFVITSIDHDIWNNLPKGLNERVHALFAASRNLAYAPRALPSALANDADTRYENTFACV
RRGVPLAPAYDPQADLPPAHLLTGTIVGAEGEEVFCDEDGRVRVRVHGLDPADHAHAQGAGTNGNAGDSA
PIRVASSLAGAHFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGAHPPATFSHAGGLPGNRYLSGIKT
KEIRGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGYLTQPRENGHGNDRGEGVELRTDAAAALRAAQGM
LLTTYARTQASGGQLDRDELIRLLGECAELFKALGDYAGQHGGQAADTAGQHAVAAAFKRWAPGTDGADA
PSDGAARALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFARGAGVQAV
AGEGPMLLQAQAGTLTANAQKGVKITTNEHEVFVSAPKIRLVAEDGSYLELGGGITLGTNGDIKLLSASH
QWGGPSTAQAAKSGFGNQPTDQRFKLHYPGEDGDLQAAANKRFRITLDDGRVIEGKTDASGLTDLVKDDA
MRIAKIDYLKPKL
-
Nucleotide Sequence: 2772 bp     [Download]
>gi|53721039|ref|NC_006351.1|:88921-91692 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
TTGAACGATACGCTACGCAATTTTGCGTCGGGGGCGGTCGACTGGAATAAACGTCCGGTCGCGTTGCACT
TTGGCGCCGCGCAGGCCGCGCTGGGCCACCTCCTCGCGCTGCAGCACGCCAGTGTTCAGGAAGGGCTGAT
GACCGGGATCCACGGCCGATTGACCTGCGTGTCGACCCGCCGCGACCTTCCGCCCGGCGTGTTGCTCGGC
ATTCCGGTTTCGATCCGGCTGATCACCGACCGCGGACAGCCGCACACGGTGAACGCGATCATCAGCGACG
TCCAGATCGGCCAAAGCGACGGCGAGCTCTGTGTGTACCAGCTGACGGTCTGCGACGCGCTGTCGCTGAT
GGACAAGCGTACCAATTCGCGGGTCTTCCGAAAGCGCAGCGTCATCGATGTGCTCGCCACGCTGTTCAAC
GAATGGCAGCAGCGCAGCCCGGCCCTCGCGCGCGCGTTCGAATTCGATCTGTCCGGCTTGCGCGCCGATC
GCTATCCGCCCCGCGAGCTGACCCGGCAGGTCAACGAATCGGATGCGCATTTCGTGCGCCGTCTGCTGCG
CCGCGAAGGGATCACCGTGTTCGCGAAGGCGGGGCCGGCGAAGGGCGAACGGCCGTTGCAGGGCGACGCG
CCCGTGCACACGCTCGTGTGCTGTGACGATCCGATGTCGTTGCCGCAAGCGCCGGCCGGCACGGTCCGCT
TGCATCCGCGCGACGGCGGCGCCGCGCAGCGCGACACGGTCACGCTGTTCGCGCTGCGTCGGCAATTGGC
GCCCGGCAAGGCCGGCCGCCCGTCGTGGGACTACAAGAAGGCGCGGATCGACGAATCGAGCGTCGCTTCG
AGCCTCGATCAGGGCGAGGCGGGCAACGATCTGGCGAAGCTGCTGACCGACATCGCGATCGACATTGCGC
ACGCGGGCGATTCATGGCGCGATCACGAGCGGCTCACCCGCGCGCGCATGCTCGCGCACGAGTTCGAAGC
CGAGCGCCATGACGGCGTCAGCAGCGTGCGGGATCTCGCCGTGGGCACATGGATCACGCTGACGGGCGAT
CCGCAATGGGACAGGCAACGCGCCGACAAGCGTCAGTTCGTGATCACGTCGATCGATCACGACATCTGGA
ACAACCTGCCGAAGGGGCTCAACGAGCGCGTGCACGCGCTGTTCGCCGCGAGCCGCAATCTCGCGTACGC
GCCCCGCGCGCTGCCGTCCGCGCTGGCGAACGACGCGGATACCCGCTACGAGAACACGTTCGCGTGCGTG
CGCCGCGGCGTGCCGCTTGCGCCCGCGTACGATCCGCAAGCCGATTTGCCGCCCGCGCATCTGCTCACGG
GCACGATTGTCGGCGCGGAGGGCGAAGAAGTGTTCTGCGACGAAGACGGCCGGGTGCGCGTGCGGGTGCA
CGGCCTCGATCCGGCGGATCACGCGCACGCGCAGGGCGCGGGCACCAACGGCAACGCGGGCGACAGCGCG
CCGATCCGCGTGGCGTCGAGCCTCGCCGGCGCCCATTTCGGCGCATCGTTCCTGCCGCGAGTCGGCATGG
AAGTCCTCCTCGGATGTCTCGGCGGCGATCCGGACCGGCTGGTGATCATCGGCGTGCTCGGTAACGGCGC
GCATCCGCCGGCGACGTTCAGCCACGCGGGCGGGCTGCCGGGCAACCGCTACCTGTCGGGCATCAAGACG
AAGGAGATTCGTGGGCAACGGTACAACCAGCTGCGTCTCGACGACACGCCGAACCAGATCAGCGCGCAAC
TGGCGAGCGAGCACGCGCATTCGCAGCTCAATCTCGGATATCTGACGCAACCGCGCGAGAACGGCCACGG
GAACGACCGCGGCGAGGGCGTGGAGTTGCGTACCGACGCGGCGGCGGCGCTGCGGGCGGCGCAAGGCATG
CTGCTGACGACCTATGCGCGCACGCAGGCGAGCGGCGGGCAACTGGACCGTGACGAGCTGATTCGGTTGC
TCGGCGAATGCGCGGAGCTGTTCAAGGCGCTGGGCGACTACGCGGGGCAGCACGGCGGGCAGGCCGCGGA
TACGGCCGGCCAGCACGCGGTGGCCGCCGCGTTCAAGCGCTGGGCGCCGGGCACGGACGGCGCCGATGCG
CCGTCCGACGGCGCAGCGCGCGCGCTGATGGCGTTCGGCGCGCAGGCCGGTTCGGTGAACGTCACGCCGA
AGACGCATGTGACGTATGCCGGCGAGAACATCGATCAGGTCGCGCAGCAGCACCTGCAACTGATGAGCGG
CCAGCGGCTGAACGCGACGGCCGGGCAGGGCATGCAGCTCTTCGCGCGGGGCGCGGGGGTGCAGGCCGTG
GCGGGCGAAGGGCCGATGCTGCTGCAGGCGCAAGCCGGCACGCTGACGGCGAACGCGCAGAAGGGCGTCA
AGATCACGACGAACGAGCACGAGGTGTTCGTGAGCGCGCCGAAGATTCGGCTCGTTGCCGAGGACGGCAG
CTACCTCGAGCTCGGCGGCGGCATCACGCTCGGCACGAACGGCGACATCAAGCTGCTGTCGGCGTCGCAC
CAGTGGGGCGGGCCGTCGACCGCGCAGGCGGCGAAGAGCGGGTTCGGCAATCAGCCGACGGATCAGCGTT
TCAAGCTGCACTATCCGGGCGAGGACGGCGATTTGCAGGCGGCGGCGAACAAGCGGTTCCGGATCACGCT
GGACGACGGGCGCGTCATCGAAGGCAAGACCGACGCGAGCGGCCTGACGGATCTGGTCAAGGACGACGCG
ATGCGTATCGCGAAGATCGACTATCTGAAGCCGAAGCTTTGA
 Primer design