SecReT6
Effector Protein ID: 53721117
SecReT6 ID77
T6SS typeA4b
Gene symbol-
Locus tagBPSS0079
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]91706..93946 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_II0090
Description
UniProt IDQ63P67
KEGG IDbps:BPSS0079
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 2.50E-122, Aligned region: 416..725
Abhydrolase_6 [PF12697], Evalue: 0.00018, Aligned region: 38..62
Abhydrolase_6 [PF12697], Evalue: 0.00018, Aligned region: 226..311
PGAP1 [PF07819], Evalue: 0.0015, Aligned region: 244..302
DUF900 [PF05990], Evalue: 0.0071, Aligned region: 37..46
DUF900 [PF05990], Evalue: 0.0071, Aligned region: 214..283
Thioesterase [PF00975], Evalue: 0.0072, Aligned region: 147..187
Thioesterase [PF00975], Evalue: 0.0072, Aligned region: 257..359
DUF2974 [PF11187], Evalue: 0.009, Aligned region: 251..316
Protein Sequence: 746 a.a.     [Download]
>gi|53721117|ref|YP_110102.1| unnamed protein product [Burkholderia pseudomallei K96243]
MNGINDQCFTAARGAGVTMSNRPGDRPVPIPRDLPGVVIFIHGVNDPGAAYATVERGLCQGLNERLSRSD
LRPGEYGRRYAAASAAKAEGDSVRYAEVLGDPDMYLYQRAETGGTHSMFLPFYWGYRASDNEIAKISHPG
EVKSRVADSDGNLMTRGQYQDIHGNRLDAHFGKGGGFFANATNNIPQMYSPGFEPDKLERTVMQNALAGN
TIFAGKSPERRYFVLAAARLANLIKTIRTIQPSALALEHGMDPQHETITVMGHSQGTIITLLAQAMLKQQ
GQRCVDCIIMVDTPYSLQFTQDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSAHSCGRAGQNW
SKTQGKRPDKGGKHWITFDERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMPA
MTVLEPKRFFQRMWTRLERDQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTMLGTLVESGKNMA
LQASFKRNDIRFINGEQLKPAYEPDLYGGEVRKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFKWKDV
ATTDDPGAGIEPHKQAFNRGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMR
TDADQLEANNYHSGVLLSSENHRWVTAMDVAIGQAVTLDDPDWRQLLLLMADWKMTSRAFKQMKECKAFN
RLDKHTRDFLDACSTYYRTGQFPAEKFVMLTLPPLVTSELKAESKT
-
Nucleotide Sequence: 2241 bp     [Download]
>gi|53721039|ref|NC_006351.1|:91706-93946 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGAACGGTATCAACGATCAGTGTTTCACCGCCGCCCGCGGGGCGGGCGTGACGATGTCGAATCGGCCCG
GCGACCGGCCCGTGCCGATTCCGCGCGATCTGCCGGGCGTGGTGATCTTCATCCACGGCGTCAACGATCC
CGGGGCGGCTTATGCCACCGTGGAGCGCGGGCTGTGCCAGGGGCTCAATGAGCGATTGTCGCGAAGCGAT
CTGCGGCCGGGGGAGTATGGCAGGCGGTATGCGGCTGCGTCGGCGGCGAAAGCCGAGGGCGATAGCGTTC
GGTATGCGGAAGTGCTGGGCGATCCGGACATGTATCTGTATCAACGTGCGGAGACCGGCGGTACTCACAG
CATGTTCCTGCCGTTCTACTGGGGCTATCGGGCGTCCGACAACGAGATCGCGAAGATCAGCCATCCGGGC
GAGGTCAAGAGCCGCGTGGCGGACAGCGACGGCAACCTGATGACGCGCGGCCAGTATCAGGACATCCACG
GCAACCGGCTCGACGCCCATTTCGGCAAGGGCGGCGGGTTTTTCGCCAACGCGACGAACAACATCCCGCA
GATGTACAGCCCGGGCTTCGAACCGGACAAGCTCGAGCGCACGGTCATGCAAAACGCGCTGGCCGGCAAT
ACGATCTTCGCCGGCAAGTCGCCCGAGCGCCGTTACTTCGTGCTGGCCGCGGCTCGCCTGGCGAATCTCA
TCAAGACCATTCGGACCATTCAGCCCTCCGCGCTCGCGCTCGAACATGGAATGGACCCTCAGCACGAAAC
GATCACGGTGATGGGGCACAGCCAGGGCACGATCATCACGCTGCTCGCGCAGGCGATGCTCAAGCAGCAA
GGGCAGCGCTGCGTCGATTGCATCATCATGGTCGATACGCCGTACAGCCTGCAGTTCACCCAGGACGGCA
GCCAGCAAACCGGGCACGCGAAGCTCAAGACGCTGGTCGACATCGTCAACGCGGTGACGAGCGAGCCGCA
TACGATTCCGGAGCTGGCCGAACTGATGATCGATTCGGCCCATTCGTGCGGCCGGGCCGGACAGAACTGG
AGCAAGACGCAGGGAAAGCGGCCGGACAAGGGCGGCAAGCACTGGATCACGTTCGACGAGCGCGACAACC
GCGGCAAGGTCTATCTGTACTTTTGCCCGGAAGATACCGTGGTCGGCCTCGACAAGGTGCGGGGGATCGG
CACGTTCGGCGTGCCCGACGAGGTGCCGGCCGATGGCGCGGCGGCCAGCCGGGGCAAAACGATGCCCGCG
ATGACGGTGCTTGAACCGAAGCGCTTCTTTCAGCGCATGTGGACGCGGCTCGAGCGCGACCAGGACGGCA
GGGGGAAGCGCTCGAAGGTCGCCGTCGGCACGCCGCCCGCGCGCGTGCCGGTTCGCGACCCGTTTCAGCG
ATTGACGCCGGGCCCCGACACGGACGGCACGATGCTTGGCACCTTGGTCGAATCCGGCAAGAACATGGCG
CTGCAGGCATCGTTCAAGCGCAACGACATTCGCTTCATCAACGGCGAGCAACTGAAACCGGCGTACGAGC
CCGATCTGTACGGGGGCGAGGTTCGGAAGGGCGGACAGGTGCCCGGGCACGCCGATGTCGCCGGGTTGAT
GCGTCCGGACGACGTGACGAAAAACGTCGCGCTCGGCAACCAGTACGCGAAGTTCAAATGGAAAGACGTC
GCGACGACGGACGATCCGGGCGCCGGCATCGAGCCGCACAAGCAGGCGTTCAATCGCGGCCGTCCGGTCG
ACGAGCAGTCGCATAACTGGCGCATCGTGCCGAGCCGGTCGCTCGGCTCGATGCTGTCGGCGGCCGCCAC
GGGCGGACGGTATCAGACGTACGTGATCCAGCGCGAGGAGACGCCGGACGAGGTTCGCAAGCGCATGCGC
ACCGATGCCGATCAACTGGAAGCGAACAACTATCATTCGGGCGTGCTGCTCAGTTCGGAGAACCATCGCT
GGGTCACGGCGATGGACGTGGCGATCGGTCAGGCGGTGACGCTGGATGATCCGGACTGGCGGCAGTTGTT
GCTTTTGATGGCGGATTGGAAGATGACGTCTCGCGCGTTTAAGCAAATGAAGGAATGCAAAGCCTTCAAC
CGATTGGATAAACATACGCGTGATTTTTTGGACGCATGCTCAACGTACTACCGAACCGGTCAATTTCCGG
CTGAGAAATTCGTGATGCTTACACTTCCGCCATTGGTTACCAGCGAACTAAAGGCTGAAAGCAAAACATG
A
 Primer design