SecReT6
Effector Protein ID: 53722235
SecReT6 ID77
T6SS typeA4b
Gene symbol-
Locus tagBPSS1212
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]1633710..1635902 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I3226
Description
UniProt IDQ63L01
KEGG IDbps:BPSS1212
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 5.40E-120, Aligned region: 400..709
Abhydrolase_6 [PF12697], Evalue: 0.00012, Aligned region: 22..45
Abhydrolase_6 [PF12697], Evalue: 0.00012, Aligned region: 210..296
DUF900 [PF05990], Evalue: 0.0046, Aligned region: 21..30
DUF900 [PF05990], Evalue: 0.0046, Aligned region: 197..267
Thioesterase [PF00975], Evalue: 0.007, Aligned region: 131..172
Thioesterase [PF00975], Evalue: 0.007, Aligned region: 242..343
Protein Sequence: 730 a.a.     [Download]
>gi|53722235|ref|YP_111220.1| unnamed protein product [Burkholderia pseudomallei K96243]
MTMANRPGDRPVPIPRDLPGVVIFIHGVNDPGAAYATVERGLCQGLNERLSRSDLRPGEYGGEYAEAIKA
KDQKSPFFDSRIANDPDMYLYRRAETGGTHSMFLPFYWGYRASDDEIAKISHPGEVKSRVADSDGNLMTR
GQYQDIHGNRLDAHFGKGGGFFANATNNIPQMYSPGFEPDKLERTVMQNALAGNTIFAGKSPDRRYFVLA
AARLASLIRTIRAVRPSALALEHGMDPRHETITVMGHSQGTIITLLAQAMLRQQGQRCVDCIIMVDTPYS
LQFTQDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSAHSCGRAGQNWSKTQGKRPDKGGKHWI
TFDERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMPAMTVLEPKRFFQRMWTR
LERDQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTMLGTLVESGKNMALQASFKRNDIRFINGE
QLKPAYEPDLYGGEVRKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFKWKDVATTDDPGAGIEPHKQA
FNRGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMRTDADQLEANNYHSGVL
LSSENHRWVTAMDVAIGQAVTLDDPDWRRLLLLMADWKMTPDAMDKIAKCNAYGRLETHTREFIDACAKY
YQNGSFPAEKFVPLTLPPLVTSELKVDKRA
-
Nucleotide Sequence: 2193 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c1635902-1633710 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
GTGACGATGGCGAATCGGCCGGGCGACCGGCCCGTGCCGATTCCGCGCGATCTGCCGGGCGTGGTGATCT
TCATCCACGGCGTCAACGATCCCGGGGCGGCTTATGCCACCGTGGAGCGCGGGCTGTGCCAGGGGCTCAA
TGAGCGATTGTCGCGAAGCGATCTGCGGCCGGGGGAGTATGGCGGGGAATATGCCGAAGCCATCAAAGCG
AAAGACCAAAAGAGCCCGTTTTTCGATAGCAGAATCGCCAACGATCCGGACATGTATCTGTATCGACGTG
CGGAGACCGGCGGCACTCACAGCATGTTCCTGCCGTTCTACTGGGGCTATCGGGCGTCCGATGACGAGAT
CGCGAAGATCAGCCATCCGGGCGAGGTCAAGAGCCGCGTCGCGGACAGCGACGGCAACCTGATGACGCGC
GGCCAGTATCAGGACATCCACGGCAACCGGCTCGACGCCCATTTCGGCAAGGGCGGCGGGTTTTTCGCCA
ACGCGACGAACAACATCCCGCAGATGTACAGCCCGGGCTTCGAACCGGACAAGCTCGAGCGCACGGTCAT
GCAAAACGCGCTGGCCGGCAATACGATCTTCGCCGGCAAGTCGCCCGATCGCCGCTATTTCGTGCTGGCC
GCGGCTCGCCTGGCGAGCCTCATCCGGACCATTCGGGCCGTCCGGCCTTCCGCGCTCGCGCTGGAGCACG
GCATGGATCCTCGACACGAAACGATCACGGTGATGGGGCACAGCCAGGGCACGATCATCACGCTGCTCGC
GCAGGCGATGCTCAGGCAGCAAGGGCAGCGCTGCGTCGATTGCATCATCATGGTCGATACGCCGTACAGC
CTGCAGTTCACCCAGGACGGCAGCCAGCAAACCGGGCACGCGAAGCTCAAGACGCTGGTCGACATCGTCA
ACGCGGTGACGAGCGAGCCGCATACGATTCCGGAGCTGGCCGAACTGATGATCGATTCGGCCCATTCGTG
CGGCCGGGCCGGACAGAACTGGAGCAAGACGCAGGGAAAGCGGCCGGACAAGGGCGGCAAGCACTGGATC
ACGTTCGACGAGCGCGACAACCGCGGCAAGGTCTATCTGTACTTTTGCCCGGAAGATACCGTGGTCGGCC
TCGACAAGGTGCGCGGGATCGGCACGTTCGGCGTGCCCGACGAGGTGCCGGCCGATGGCGCGGCGGCCAG
CCGGGGCAAAACGATGCCCGCGATGACGGTGCTTGAGCCGAAGCGCTTCTTTCAGCGCATGTGGACGCGG
CTCGAGCGCGACCAGGACGGCAGGGGAAAGCGCTCGAAGGTCGCCGTCGGCACGCCGCCCGCGCGCGTGC
CGGTTCGCGACCCGTTTCAGCGATTGACGCCGGGCCCCGACACGGACGGCACGATGCTTGGCACCTTGGT
CGAATCCGGCAAGAACATGGCGCTGCAGGCATCGTTCAAGCGCAACGACATTCGCTTCATCAACGGCGAG
CAACTGAAACCGGCGTACGAGCCCGATCTGTACGGGGGCGAGGTTCGGAAGGGCGGACAGGTGCCCGGGC
ACGCCGATGTCGCCGGGTTGATGCGTCCGGACGACGTGACGAAAAACGTCGCGCTCGGCAACCAGTACGC
GAAGTTCAAATGGAAAGACGTCGCGACGACGGACGATCCGGGCGCCGGCATCGAGCCGCACAAGCAGGCA
TTCAATCGCGGCCGTCCGGTCGACGAGCAGTCGCATAACTGGCGCATCGTGCCGAGCCGGTCGCTCGGCT
CGATGCTGTCGGCGGCCGCCACGGGCGGACGGTATCAGACGTACGTGATCCAGCGCGAGGAGACGCCGGA
CGAGGTTCGCAAGCGCATGCGTACCGATGCCGATCAACTGGAAGCGAACAACTATCATTCGGGCGTACTG
CTCAGTTCGGAGAACCATCGCTGGGTCACGGCGATGGACGTGGCGATCGGTCAGGCGGTGACGCTGGATG
ATCCGGACTGGCGGCGGTTGTTGCTTTTGATGGCGGATTGGAAGATGACGCCGGATGCAATGGATAAGAT
CGCGAAATGCAACGCTTATGGCCGGCTTGAGACGCATACGAGGGAATTTATCGATGCGTGCGCGAAGTAC
TATCAAAATGGCTCGTTCCCTGCGGAGAAGTTTGTGCCGCTTACTTTGCCACCACTCGTCACCAGCGAAC
TGAAAGTTGACAAGAGAGCATGA
 Primer design