SecReT6
Effector Protein ID: 53722236
SecReT6 ID77
T6SS typeA4b
Gene symbol-
Locus tagBPSS1213
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]1635964..1638741 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I3225
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ63L00
KEGG IDbps:BPSS1213
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-56, Aligned region: 44..375
DUF2345 [PF10106], Evalue: 5.10E-42, Aligned region: 611..643
DUF2345 [PF10106], Evalue: 5.10E-42, Aligned region: 697..848
T6SS_Vgr [PF13296], Evalue: 3.10E-39, Aligned region: 560..668
T6SS_Vgr [PF13296], Evalue: 3.10E-39, Aligned region: 737..802
Phage_base_V [PF04717], Evalue: 1.40E-18, Aligned region: 459..543
Protein Sequence: 925 a.a.     [Download]
>gi|53722236|ref|YP_111221.1| unnamed protein product [Burkholderia pseudomallei K96243]
MNDTLRNFASGAVDWNKRPVALHFGAAQAALGHLLALQHASVQEGLMTGIHGRLTRVSTRRDLPPGVLLG
IPVSIRLITDRGQPHTVNAIISDVQIGQSDGELCVYQLTVCDALSLMDKRTNSRVFRKRSVIDVLATLFN
EWQQRSPALARAFEFDLSGLRADRYPPRELTRQVNESDAHFVRRLLRREGITVFAKAGPAKGERPLQGDA
PVHTLVCCDDPMSLPQAPAGTVRLHPRDGGAAQRDTVTLFALRRQLAPGKAGRPSWDYKKARIDESSVAS
SLDQGEAGNDLAKLLTDIAIDIAHAGDSWRDHERLTRARMLAHEFEAERHDGVSSVRDLAVGTWITLTGD
PQWDRQRADKRQFVITSIDHDIWNNLPKGLNERVHALFAASRNLACAPRALPSALANDADTRYENTFACV
RRGVPLAPAYDPQADLPPAHLLTGTIVGAEGEEVFCDEDGRVRVRVHGLDPADHAHAQGAGTNGNAGDSA
PIRVASSLAGAYFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGAHPPATFSHAGGLPGNRYLSGIKT
KEIRGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGYLTQPRENGHGNDRGEGVELRTDAAAALRAAQGM
LLTTYARTQASGGQLDRDELIRLLGECAELFKALGDYAGQHGGQAADTAGQYAVAAAFKRWAPGTGTDGA
DAPSDGAARALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFARGAGVQ
AVAGEGPMLLQAQAGTLTANAQKGVKITTNEHEVFVSAPKIRLVAEDGSYLELGGGITLGTNGDIKLLSA
SHQWGGPSTAQAAKSGFGNQPTDQRFKLHYPGEDGDLQAAANKRFRITLDDGRVIEGKTDASGLTDLVKD
DAMRIAKIDYLKPKL
-
Nucleotide Sequence: 2778 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c1638741-1635964 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
TTGAACGATACGCTACGCAATTTTGCGTCGGGGGCGGTCGACTGGAATAAACGTCCGGTCGCGTTGCACT
TTGGCGCCGCGCAGGCCGCGCTGGGCCACCTCCTCGCGCTGCAGCACGCCAGTGTTCAGGAAGGCCTGAT
GACCGGGATCCACGGCCGATTGACCCGCGTGTCGACCCGCCGCGATCTTCCGCCCGGCGTGTTGCTCGGC
ATTCCGGTTTCGATCCGGCTGATCACCGACCGCGGACAGCCGCACACGGTGAACGCGATCATCAGCGACG
TCCAGATCGGCCAAAGCGACGGCGAGCTCTGTGTGTACCAGCTGACGGTCTGCGACGCGCTGTCGCTGAT
GGACAAGCGCACCAATTCGCGGGTCTTCCGAAAGCGCAGCGTCATCGATGTGCTCGCCACGCTGTTCAAC
GAATGGCAGCAGCGCAGCCCGGCCCTCGCGCGCGCGTTCGAATTCGATCTGTCCGGCTTGCGCGCCGATC
GCTATCCGCCCCGCGAGCTGACCCGGCAGGTCAACGAATCGGATGCGCATTTCGTGCGCCGTCTGCTGCG
CCGCGAAGGGATCACCGTGTTCGCGAAGGCGGGGCCGGCGAAGGGCGAACGGCCGTTGCAGGGCGACGCG
CCCGTGCACACGCTCGTGTGCTGTGACGATCCGATGTCGTTGCCGCAAGCGCCGGCCGGCACGGTCCGCT
TGCATCCGCGCGACGGCGGCGCCGCGCAGCGCGACACGGTCACGCTGTTCGCGCTGCGTCGGCAATTGGC
GCCCGGCAAGGCCGGCCGCCCGTCGTGGGACTACAAGAAGGCGCGGATCGACGAATCGAGCGTCGCTTCG
AGCCTCGATCAGGGCGAGGCGGGCAACGATCTGGCGAAGCTGCTGACCGACATCGCGATCGACATTGCGC
ACGCGGGCGATTCATGGCGCGATCACGAGCGGCTCACCCGCGCGCGCATGCTCGCGCACGAGTTCGAAGC
CGAGCGCCATGACGGCGTCAGCAGCGTGCGGGATCTCGCCGTGGGCACATGGATCACGCTGACGGGCGAT
CCGCAATGGGACAGGCAACGCGCCGACAAGCGTCAGTTCGTGATCACGTCGATCGATCACGACATCTGGA
ACAACCTGCCGAAGGGGCTCAACGAGCGCGTGCACGCGCTGTTCGCCGCAAGCCGCAATCTCGCGTGCGC
GCCCCGCGCGCTGCCGTCCGCGCTGGCGAACGACGCGGATACCCGCTACGAGAACACGTTCGCGTGCGTG
CGCCGCGGCGTGCCGCTTGCGCCCGCGTACGATCCGCAAGCCGATTTGCCGCCCGCGCATCTGCTCACGG
GCACGATTGTCGGCGCGGAGGGCGAAGAAGTGTTCTGCGACGAAGACGGCCGGGTGCGCGTGCGGGTGCA
CGGCCTCGATCCGGCGGATCACGCGCACGCGCAGGGCGCGGGCACCAACGGCAACGCGGGCGACAGCGCG
CCGATCCGCGTGGCGTCGAGCCTCGCCGGCGCCTATTTCGGCGCATCGTTCCTGCCGCGAGTCGGCATGG
AAGTCCTCCTCGGGTGTCTCGGCGGCGATCCGGACCGGCTGGTGATCATCGGCGTGCTCGGTAACGGCGC
GCATCCGCCGGCGACGTTCAGCCACGCGGGCGGGCTGCCGGGCAACCGCTACCTGTCGGGCATCAAGACG
AAGGAGATTCGTGGGCAACGGTACAACCAGCTGCGTCTCGACGACACGCCGAACCAGATCAGCGCGCAAC
TGGCGAGCGAGCACGCGCATTCGCAGCTCAATCTCGGATATCTGACGCAACCGCGCGAGAACGGCCACGG
GAACGACCGCGGCGAGGGCGTGGAGTTGCGTACCGACGCGGCGGCGGCGCTGCGGGCGGCGCAAGGCATG
CTGCTGACGACCTATGCGCGCACGCAGGCGAGCGGCGGGCAACTGGACCGTGACGAGCTGATTCGGTTGC
TCGGCGAATGCGCGGAGCTGTTCAAGGCGCTGGGCGACTACGCGGGGCAGCACGGCGGGCAGGCCGCGGA
TACGGCCGGCCAGTACGCGGTGGCCGCCGCGTTCAAGCGCTGGGCGCCGGGCACGGGCACGGACGGCGCC
GATGCGCCGTCCGACGGCGCAGCGCGCGCGCTGATGGCGTTCGGCGCGCAGGCCGGTTCGGTGAACGTCA
CGCCGAAGACGCATGTGACGTATGCCGGCGAGAACATCGATCAGGTCGCGCAGCAGCACCTGCAACTGAT
GAGCGGCCAGCGGCTGAACGCGACGGCCGGGCAGGGCATGCAGCTCTTCGCGCGGGGCGCGGGGGTGCAG
GCCGTGGCGGGCGAAGGGCCGATGCTGCTGCAGGCGCAAGCCGGCACGCTGACGGCGAACGCGCAGAAGG
GCGTCAAGATCACGACGAACGAGCACGAGGTGTTCGTGAGCGCGCCGAAGATTCGGCTCGTTGCCGAGGA
CGGCAGCTACCTCGAGCTCGGCGGCGGCATCACGCTCGGCACGAACGGCGACATCAAGCTGCTGTCGGCG
TCGCACCAGTGGGGCGGGCCGTCGACCGCGCAGGCGGCGAAGAGCGGGTTCGGCAATCAGCCGACGGATC
AGCGTTTCAAGCTGCACTATCCGGGCGAGGACGGCGATTTGCAGGCGGCGGCGAACAAGCGGTTCCGGAT
CACGCTGGACGACGGGCGCGTCATCGAAGGCAAGACCGACGCGAGCGGCCTGACGGATCTGGTCAAGGAC
GACGCGATGCGTATCGCGAAGATCGACTATCTGAAGCCGAAGCTTTGA
 Primer design