SecReT6
Effector Protein ID: 53722520
SecReT6 ID75
T6SS typeA1
Gene symbol-
Locus tagBPSS1498
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2043052..2043561 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBMAA0742
DescriptionHcp protein
UniProt IDQ63K67
KEGG IDbps:BPSS1498
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-24, Aligned region: 6..155
Protein Sequence: 169 a.a.     [Download]
>gi|53722520|ref|YP_111505.1| unnamed protein product [Burkholderia pseudomallei K96243]
MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTITLTKEMDRSSP
QFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQYSPTPHKDDSNGIKEGLLGY
IEEIKFTYSGYSLEHAESGIAGAANWTNG
-
Nucleotide Sequence: 510 bp     [Download]
>gi|53721039|ref|NC_006351.1|:2043052-2043561 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGCTGGCCGGAATATATCTCAAGGTCAAAGGAAAAACCCAGGGGGAAATCAAAGGCTCCGTCGTTCAGG
AAGGTCATGACGGGAAAATCCACATCCTCGCCTTCAAGAACGACTACGACATGCCTGCCAGGCTCCAGGA
AGGCCTGACGCCCGCCGCCGCCGCTCGCGGCACGATCACGTTGACGAAGGAAATGGACAGATCGTCGCCG
CAATTCCTGCAGGCGCTCGGCAAGCGCGAGATGATGGAAGAGTTCGAGATCACGATCCACCGTCCGAAGA
CGGATACAACAGGTGGGGACCTGACCGAACTCCTGTTCACGTACAAGTTCGAAAAAGTGCTGATCACCCA
CATGGACCAATACTCGCCCACGCCGCACAAAGACGATAGCAACGGCATCAAGGAAGGCTTGCTCGGCTAT
ATCGAGGAGATCAAGTTCACGTATTCGGGATACTCGTTGGAACACGCGGAATCGGGCATCGCGGGCGCCG
CAAACTGGACGAATGGCTGA
 Primer design

Reference
(1) Burtnick MN et al. (2011). The cluster 1 type VI secretion system is a major virulence determinant in Burkholderia pseudomallei. Infect Immun. 79(4):1512-25. [PudMed:21300775] experimental
 
experimental experimental literature