SecReT6
Effector Protein ID: 53722534
SecReT6 ID75
T6SS typeA1
Gene symbol-
Locus tagBPSS1512
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2065185..2066609 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBMAA0729
Descriptionputative deubiquitinase
UniProt IDQ63K53
KEGG IDbps:BPSS1512
PDB IDNA
Domain hit(s) vs Pfam Big_5 [PF13205], Evalue: 4.50E-10, Aligned region: 141..141
Big_5 [PF13205], Evalue: 4.50E-10, Aligned region: 176..275
UCH [PF00443], Evalue: 8.60E-08, Aligned region: 282..314
UCH [PF00443], Evalue: 8.60E-08, Aligned region: 423..455
Protein Sequence: 474 a.a.     [Download]
>gi|53722534|ref|YP_111519.1| unnamed protein product [Burkholderia pseudomallei K96243]
MNARRPAFGLIASHASRRRAVESVRAHFPLMFTLCLAMKHTSNHSDPSGAPSSARRAASDSSRLVRGMRS
PQRGGAALALAVASLAGCGGGDSGEPAPREFAPPTVQLAYPTQPNSPVAPAPTAHVSSGHTPPATAPAAM
PTASPTATPTASPTATAAASPSAPSTATPNAPPAAPPAVVATRVPPTHAALRRPTIELEFDRAIEPGSVP
HIALRADDGTSVAVGPLSWLSDRRIAFAPRKPLKSNSRYEIMVPAGIRSTTGERSAHPLTSSFDTAPVTP
PRGLPNLDGASCFINTALQLAVHSSALDDILSNEAVPPAVRTLLEDYDAASADALDAQLAAAVAALRATP
EVPDSGPGQTLEVMQALRMPLYDTSSANNATNNADAIRHAPPNTKAFFLNSYPPLSYADLPNHDRLVAFD
YSTGGHYVAYVKRDGIWYRIDDAQVSAVNEQDLLALPAFNPANGSVSIEIAIYR
-
Nucleotide Sequence: 1425 bp     [Download]
>gi|53721039|ref|NC_006351.1|:2065185-2066609 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGAACGCTCGACGTCCGGCGTTCGGCCTGATTGCGTCGCACGCGTCACGCCGCCGGGCCGTCGAATCCG
TTCGCGCCCACTTTCCGCTCATGTTCACCCTCTGTCTTGCGATGAAACACACTTCGAACCACTCCGACCC
TTCCGGTGCGCCGTCGTCAGCGCGACGCGCCGCATCCGATTCGTCCCGCCTCGTCCGCGGCATGCGCTCG
CCCCAACGCGGCGGCGCGGCACTGGCGCTGGCCGTCGCCTCGCTCGCCGGATGCGGGGGCGGCGATTCGG
GCGAACCCGCTCCACGCGAATTCGCGCCCCCGACAGTGCAACTCGCCTACCCGACGCAACCGAACTCGCC
CGTCGCACCAGCGCCCACCGCGCACGTATCAAGCGGACACACGCCTCCGGCCACGGCGCCCGCCGCGATG
CCCACCGCTTCACCCACCGCGACGCCTACCGCTTCACCCACCGCGACGGCTGCCGCTTCGCCCTCCGCGC
CATCCACTGCGACGCCCAACGCCCCGCCCGCCGCTCCGCCGGCCGTCGTCGCCACCCGCGTCCCGCCGAC
GCACGCGGCGTTGCGCCGCCCGACGATCGAACTCGAATTCGATCGCGCGATCGAGCCGGGTTCAGTCCCA
CACATCGCGCTGCGCGCCGACGATGGCACGAGCGTCGCCGTCGGCCCGTTGTCGTGGCTGAGCGATCGCC
GGATCGCGTTCGCGCCGCGCAAACCGCTCAAGTCGAACAGCCGCTACGAAATCATGGTGCCCGCCGGCAT
CAGGAGCACCACGGGCGAACGGTCGGCTCATCCGCTAACGAGCAGCTTCGATACCGCGCCCGTCACGCCG
CCGCGCGGCCTGCCCAATCTCGACGGCGCCTCGTGCTTCATCAACACGGCGCTGCAATTGGCGGTTCACT
CGTCGGCGCTCGACGACATTCTGTCGAACGAAGCCGTCCCGCCCGCCGTCCGCACGCTGCTCGAAGACTA
CGACGCCGCATCGGCTGACGCACTCGACGCGCAGTTGGCCGCCGCGGTCGCCGCGCTGCGCGCCACGCCG
GAGGTCCCGGACAGCGGGCCGGGACAAACGCTGGAAGTGATGCAAGCGTTGCGGATGCCGTTATATGACA
CGAGCAGCGCGAACAACGCAACGAACAACGCCGACGCCATACGTCATGCGCCGCCCAACACCAAGGCGTT
CTTTCTGAACTCCTATCCACCGCTTTCCTACGCGGATCTGCCGAACCACGACCGGCTCGTCGCGTTCGAC
TACAGCACGGGCGGTCACTATGTCGCTTATGTGAAGCGGGATGGAATCTGGTATCGAATCGACGATGCCC
AGGTCAGCGCCGTCAACGAACAGGACTTGCTTGCCCTGCCGGCGTTCAACCCCGCTAACGGCAGCGTGTC
GATCGAAATCGCGATCTATCGATGA
 Primer design