SecReT6
Effector Protein ID: 53723040
SecReT6 ID77
T6SS typeA4b
Gene symbol-
Locus tagBPSS2022
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2732831..2733736 [+]
Productouter membrane protein
Effector typeProtein
Homologous effectorBTH_II0310
Description
UniProt IDQ63IP7
KEGG IDbps:BPSS2022
PDB IDNA
Domain hit(s) vs Pfam B_lectin [PF01453], Evalue: 8.90E-11, Aligned region: 87..134
B_lectin [PF01453], Evalue: 8.90E-11, Aligned region: 190..229
Protein Sequence: 301 a.a.     [Download]
>gi|53723040|ref|YP_112025.1| unnamed protein product [Burkholderia pseudomallei K96243]
MKKYALALWFMLVSSMSAMAGAIIPSGATLVAGQYAISNNGNFAFGVDAASGKLYFHYRFPTQAWGASAM
SQMYGTQPEGALYVGKGDRLVMQTDGRLVFYSGNDVVWSNWYYGPAPIPGSYAVVEDFGVVAIYPPQGGY
PTFTWPFASVTPNSGALATVVGYPFGVNFPVLNGRQWLQIFNNVTYYLWNKSFAADSVAMQTDGNLVVYN
KGQPVWSTGTSGNPGAYMLVTPVGFVLGKQYGGILANVPYPVSVDQSSRASGPNDPKPTPAAPPPPSLNL
PINASWKCYYVKDWLACYAPG
-
Nucleotide Sequence: 906 bp     [Download]
>gi|53721039|ref|NC_006351.1|:2732831-2733736 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGAAAAAATACGCATTGGCGCTCTGGTTCATGCTGGTTTCATCGATGTCGGCAATGGCGGGGGCGATCA
TTCCATCGGGCGCAACGCTGGTTGCGGGGCAATACGCGATATCGAACAACGGCAACTTCGCGTTCGGCGT
CGACGCCGCCAGCGGCAAGCTCTATTTCCACTACAGGTTCCCGACGCAGGCGTGGGGCGCGAGCGCGATG
TCGCAAATGTACGGAACGCAGCCCGAGGGCGCGCTCTACGTCGGCAAGGGCGACCGGCTCGTGATGCAGA
CCGACGGGCGGCTCGTGTTCTATTCGGGCAACGACGTCGTCTGGAGCAACTGGTATTACGGCCCCGCGCC
GATCCCCGGCTCGTATGCGGTCGTCGAGGATTTCGGCGTCGTCGCGATCTATCCGCCGCAGGGCGGCTAT
CCGACGTTCACCTGGCCGTTCGCGTCGGTCACGCCGAACAGCGGCGCGCTCGCGACGGTGGTCGGCTATC
CGTTCGGCGTGAACTTCCCGGTGCTCAACGGGCGCCAATGGCTGCAGATCTTCAACAACGTCACTTACTA
CCTGTGGAACAAGAGCTTCGCCGCGGACAGCGTCGCGATGCAGACCGACGGCAATCTCGTCGTCTACAAC
AAGGGGCAGCCGGTCTGGTCGACGGGAACGTCGGGCAATCCGGGCGCCTACATGCTGGTGACGCCTGTCG
GCTTCGTGCTCGGCAAGCAGTACGGCGGCATCCTCGCGAACGTGCCCTACCCGGTGTCCGTCGATCAGTC
GAGCCGCGCGAGCGGCCCGAACGATCCGAAGCCGACGCCGGCCGCGCCGCCGCCGCCCTCGCTGAACCTG
CCGATCAATGCGAGCTGGAAGTGCTATTACGTGAAGGACTGGCTCGCGTGCTACGCGCCGGGTTGA
 Primer design