SecReT6
Effector Protein ID: 537455114
SecReT6 ID844
T6SS typeA1
Gene symbol-
Locus tagN175_13420
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]2841456..2844716 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0020
DescriptionVasX protein
UniProt IDT1Y1V7
KEGG IDlag:N175_13420
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1086 a.a.     [Download]
>gi|537455114|ref|YP_008489050.1| hypothetical protein N175_13420 [Listonella anguillarum M3]
MSNPNQAAKTGQTNDAQNPASACPFKQPLIGIIPVRYAFDVYDKQGQALHSLPEADRQWKGQFSTKQRSY
TLRQLRDGWLYVYDETAKTLHEYEVVGSTLTKIEWSDDEASKPTHERGSKGESKSCLLYPAQHTLSIGYA
HQRWTWRVCEHMRSNTSSRHAVMRKVSLKQFESNGTHLHAHFAQYLEDYVADIGTPAEQDIFKATCTPSL
PVEKSEEAAIDTEFKFVADKAVVSCSDYLQDLPEQNCGLFVALNDPLADVSDLFITFTTQVKKRTKAVGN
EEQQHAMQMAELTRTLGRIRLEEKEIPDFVKQDPIRILELERAITEYWATAELAEMEFSQLASEGITPSK
ALSPMQQQADQQLAELKTLYRFEPTSAQMRKWRKKDNGFNDEVRWADLDNFLVEHYTQLKGLDEQIKQHY
AQFMSAFNQLGLDPILLGIDNQDEIQQAYLLALISQFLVAVTQVNHDEKALETLKKELSFDSPKNLMALA
STGFSLQANQAINSHIQDFSTSFLSTGNPSDMVAFSAAIANWDTFTGDGRIREKAWFKTWIEPVQSSFGA
LQKAVANQAKESWQVVMELLFPYQTQPKGGTPSLLANLRLLLVESLVREEAVLQHNPKYAAEIKQFETKL
NAILQEMNNALELKPGNVSPKNHQIATAQSAQRKLGQLLSSELPMMLTLKNQAVMNTFQQSVNEKLSALS
KNVKTSSASVSQKLGGLGGLLFALNLWNTMAVLENIRGKVAQYPSWDPSKNPALGEAIYATGYTIVAAGA
ISAGRAWKTIVKYELLDKSLKEALGEASSLKAKDALKTFSKSIALVATVGMIASALETWESWGKFNDSSK
TDLERFGYLLKAGATGAQALIFAIQLGVYGVSRFIGFGTIAAISAGWMAAGFAVIGIVYLIGVILTNVFK
RSELEIWLSKSMWGKESAHWSVGKELIELERLLHRPSLRLSQVTQRKAAQWMDSGSLQWQLELTLPDYLK
GQTIGLQITRLPAQPAYYQRQREAVTPILINEQQGKWSIEDNQPVYRITLGGSEKDTVGVCVALPLHWVK
EQSLKFCARGTRVGELDLQSAEANDIATRNLVVGKG
-
Nucleotide Sequence: 3261 bp     [Download]
>gi|537452888|ref|NC_022223.1|:c2844716-2841456 Listonella anguillarum M3 chromosome 1, complete sequence
ATGAGTAATCCCAATCAAGCTGCGAAAACAGGGCAGACCAATGATGCGCAAAATCCCGCCAGTGCATGTC
CTTTTAAACAGCCGTTAATAGGGATAATTCCTGTTCGTTACGCCTTTGATGTTTATGATAAGCAAGGTCA
AGCATTACACTCTTTACCCGAAGCTGATCGACAGTGGAAAGGTCAATTCTCTACCAAGCAGCGTAGCTAC
ACCTTAAGGCAACTGCGTGATGGCTGGCTCTATGTCTATGATGAAACAGCAAAAACACTGCACGAATATG
AAGTCGTTGGTAGCACCTTGACCAAAATTGAGTGGTCTGACGATGAGGCAAGCAAACCCACTCACGAGCG
CGGCTCGAAAGGTGAAAGCAAAAGTTGTTTACTCTATCCCGCCCAGCACACTCTCTCTATCGGTTATGCG
CATCAACGATGGACGTGGCGAGTGTGTGAGCATATGCGCTCCAATACCAGCAGTCGTCATGCTGTGATGC
GTAAAGTGAGCCTTAAACAGTTTGAGTCCAATGGTACTCACCTTCATGCGCATTTTGCTCAGTATCTTGA
AGACTATGTGGCGGACATCGGGACGCCCGCTGAGCAGGATATTTTTAAAGCTACTTGTACCCCTTCATTA
CCGGTAGAGAAAAGTGAAGAAGCGGCGATAGATACCGAATTCAAGTTCGTGGCCGACAAAGCGGTGGTGA
GCTGCAGTGATTATTTGCAAGATTTGCCGGAGCAAAACTGCGGTTTATTTGTGGCGCTGAATGACCCTTT
AGCGGATGTGTCAGATTTATTTATTACTTTTACTACCCAAGTGAAAAAGCGAACTAAAGCGGTTGGTAAT
GAAGAGCAACAGCATGCCATGCAGATGGCAGAGCTGACACGCACATTAGGCCGAATTCGTCTTGAAGAAA
AAGAAATTCCCGATTTTGTAAAACAAGATCCTATCCGTATTTTAGAGTTAGAAAGAGCCATTACTGAATA
TTGGGCTACGGCTGAATTAGCCGAAATGGAATTTAGCCAATTAGCCAGTGAAGGGATCACGCCATCAAAG
GCGCTTTCCCCCATGCAGCAGCAAGCGGATCAGCAATTGGCGGAATTGAAAACACTCTATCGTTTTGAAC
CCACCAGTGCTCAGATGCGCAAGTGGCGCAAAAAAGACAACGGTTTTAACGATGAAGTGCGCTGGGCGGA
TTTAGATAACTTTTTGGTGGAGCATTACACCCAACTCAAAGGATTGGATGAACAGATTAAACAGCACTAT
GCGCAGTTTATGTCTGCCTTCAACCAGCTTGGCCTTGACCCGATTCTACTTGGTATAGATAACCAAGATG
AGATCCAGCAAGCGTATTTGTTAGCGTTAATTAGCCAATTTCTAGTGGCAGTTACGCAAGTCAATCATGA
TGAGAAAGCGCTTGAGACCCTCAAAAAAGAGCTCAGTTTTGATTCACCGAAAAACCTCATGGCGCTCGCG
TCAACAGGCTTTTCTCTGCAGGCGAATCAAGCCATTAACAGCCACATCCAAGATTTTAGCACCTCCTTTC
TCTCTACCGGTAATCCTAGTGATATGGTGGCGTTTTCGGCCGCGATCGCAAACTGGGATACTTTCACGGG
AGATGGCCGCATTCGGGAAAAAGCATGGTTTAAGACATGGATTGAACCCGTTCAATCGAGTTTTGGTGCA
CTGCAAAAAGCGGTAGCCAATCAAGCTAAAGAGAGTTGGCAAGTGGTGATGGAGTTGCTGTTTCCTTATC
AGACTCAGCCCAAAGGAGGAACGCCCAGTTTGCTGGCTAACCTTCGCTTATTATTAGTGGAAAGCCTAGT
ACGAGAAGAGGCGGTGTTGCAACATAACCCCAAGTATGCGGCTGAGATTAAGCAATTTGAGACTAAGTTG
AATGCCATCTTGCAAGAGATGAATAATGCTCTGGAACTCAAGCCCGGTAATGTGAGCCCGAAAAACCATC
AAATTGCGACCGCGCAATCCGCACAACGTAAGCTAGGGCAATTACTCAGTAGTGAACTGCCGATGATGCT
GACGCTCAAAAACCAAGCGGTGATGAACACTTTTCAGCAGTCGGTAAATGAGAAACTGAGCGCGTTATCG
AAAAACGTCAAAACCAGTAGCGCGTCGGTGAGTCAAAAACTGGGTGGATTAGGGGGCTTGCTGTTTGCAC
TGAACCTATGGAATACCATGGCGGTTTTGGAGAATATCCGCGGTAAGGTCGCACAATACCCCAGTTGGGA
TCCTTCGAAGAATCCGGCGTTGGGCGAAGCCATTTATGCCACTGGCTATACCATTGTGGCCGCCGGTGCC
ATCAGTGCTGGGCGCGCTTGGAAGACGATTGTTAAATATGAGCTTTTGGATAAATCACTAAAAGAAGCAT
TAGGTGAGGCATCCAGCCTTAAAGCCAAAGATGCCCTAAAAACTTTTTCTAAATCCATCGCCTTGGTGGC
TACCGTGGGCATGATTGCCAGCGCATTAGAAACATGGGAAAGCTGGGGTAAGTTTAATGACAGCAGTAAA
ACCGATCTTGAACGCTTCGGTTATTTATTAAAAGCAGGGGCAACGGGAGCACAGGCTCTGATTTTTGCTA
TTCAGTTAGGTGTATACGGAGTAAGTCGATTCATAGGTTTTGGAACAATCGCAGCCATCAGTGCTGGTTG
GATGGCCGCCGGTTTTGCTGTGATTGGTATTGTCTATTTGATCGGGGTGATTTTGACCAATGTGTTTAAA
CGCTCAGAGTTAGAAATCTGGTTATCAAAATCGATGTGGGGGAAAGAGAGTGCTCATTGGTCGGTGGGCA
AAGAATTGATCGAGTTAGAGCGCCTTCTCCATCGTCCGAGTCTTCGGTTGAGTCAAGTTACGCAACGTAA
AGCAGCGCAATGGATGGATTCAGGTTCTTTACAATGGCAGTTAGAACTCACGTTACCCGATTATCTTAAA
GGGCAGACGATAGGCTTACAAATCACCCGTTTGCCAGCGCAGCCGGCATATTATCAACGGCAAAGGGAGG
CGGTAACACCAATACTCATCAATGAACAACAGGGAAAATGGAGTATTGAAGATAATCAGCCTGTGTATCG
CATTACACTGGGTGGCAGTGAGAAGGATACCGTTGGAGTTTGCGTTGCACTGCCCCTGCACTGGGTCAAG
GAACAGAGTCTCAAATTTTGCGCCCGCGGAACTCGCGTGGGGGAATTAGATTTACAATCTGCAGAGGCGA
ATGATATTGCCACAAGAAATCTCGTTGTAGGAAAGGGTTAA
 Primer design