SecReT6
Effector Protein ID: 537455116
SecReT6 ID844
T6SS typeA1
Gene symbol-
Locus tagN175_13430
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]2845600..2847696 [-]
Producttype IV secretion protein Rhs
Effector typeProtein
Homologous effectorVCA0018
Descriptiontype VI secretion system Vgr family protein
UniProt IDT1Y177
KEGG IDlag:N175_13430
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.40E-62, Aligned region: 43..336
Phage_base_V [PF04717], Evalue: 5.10E-23, Aligned region: 375..468
DUF2345 [PF10106], Evalue: 0.00098, Aligned region: 575..619
Phage_Mu_Gp45 [PF06890], Evalue: 0.0028, Aligned region: 427..454
Phage_Mu_Gp45 [PF06890], Evalue: 0.0028, Aligned region: 571..606
Protein Sequence: 698 a.a.     [Download]
>gi|537455116|ref|YP_008489052.1| type IV secretion protein Rhs [Listonella anguillarum M3]
MATLNFTLKVDGLADDAFVVREYQGQESLSESVLANGEPCYGFRYHIELASRQSTLSAIDVVDKTAQLTV
FRNGGVVQRVHGIVRQFSKGDIGHHHTFYSLTLVPALERLSLRQNSRIFQLKTVPEILSIVLQEMGIDDY
AFALKRECLQREFCVQYRETDIHFLHRLAAEEGLVYHLLHEEGKHTLIFSDDSQSLTKLDTPIPYNVLSG
GIVDTPYISNLISHTQSQVAESQLADYSFKKPIYGFKQSALGTAMDYQQTHYEHFDFPGRFKDDESGKAF
NQIRLEYLRRQARTAQGQSNEARLQAGTLFDLAEHLDDSVNRDWVVVQVNHQGRQPQALEESGGSGATTY
SNQFTLIPADVTWRATPHTKPQVDGPCIAHVVGPDGEEIFCDEYGRVKLHFPWDRYSNGDEHSSCWVRVS
QGWAGSQYGMMAIPRIGHEVIVDFLNGDPDQPIVTGRAYHATNKAPYTLPDNKTKTVLRSETHQGEGFNE
LSFEDQAGQEKIYLHAQKDYEALVLNDSTTHIKHDKHLTVDNDQFSHIKNNQHLTVEGESRQKIALDRSL
DVGGSLHQKIGEKTVFDSGNEVHLKAGNKLVLDAGNEITIKAAGSFIKVDGGGVYLVGPAINLNSGGSAG
SGSGYGGVVAALPQGVDEAKTPQDIELAAVTPTQQSMSPLLKARQIEALKGPAPVCEVCEVCEEAKGN
-
Nucleotide Sequence: 2097 bp     [Download]
>gi|537452888|ref|NC_022223.1|:c2847696-2845600 Listonella anguillarum M3 chromosome 1, complete sequence
ATGGCCACGCTGAATTTTACGTTAAAGGTTGACGGGCTCGCCGACGATGCATTTGTGGTGCGAGAATACC
AAGGACAAGAATCCTTATCGGAGAGTGTGCTGGCCAATGGCGAGCCTTGTTATGGGTTTCGTTACCACAT
TGAGCTAGCAAGCCGTCAATCAACTTTGAGTGCAATCGATGTCGTCGACAAAACGGCTCAGCTAACGGTT
TTTCGTAATGGCGGGGTGGTGCAGCGCGTGCATGGCATCGTGCGCCAGTTTAGTAAAGGCGATATTGGTC
ATCATCACACCTTTTACTCACTCACTTTAGTGCCTGCATTAGAGCGCTTGTCGCTGCGCCAAAATAGCCG
CATCTTCCAGCTTAAAACTGTACCTGAAATTCTTTCCATTGTGCTGCAAGAAATGGGCATTGACGACTAC
GCCTTCGCACTTAAACGAGAATGTCTTCAGCGCGAATTCTGCGTACAGTACCGTGAAACCGATATCCACT
TTTTACACCGCTTAGCCGCTGAAGAGGGCTTGGTCTACCACCTCCTGCATGAAGAAGGTAAACATACCCT
CATTTTCAGTGACGACAGTCAAAGCTTAACGAAGCTCGATACACCGATCCCTTACAATGTGCTGTCCGGT
GGTATCGTTGATACGCCTTACATTTCCAACTTAATCAGCCATACGCAATCGCAAGTGGCGGAAAGCCAAT
TGGCGGATTACAGCTTTAAAAAACCGATTTACGGTTTTAAGCAAAGTGCACTCGGCACCGCGATGGATTA
CCAGCAGACCCACTATGAACATTTTGATTTCCCGGGTCGATTTAAAGACGATGAGAGCGGTAAAGCGTTT
AATCAAATTCGTTTAGAGTACCTAAGAAGGCAGGCGCGTACCGCACAAGGCCAAAGCAATGAAGCGCGTT
TGCAAGCCGGAACCCTGTTTGATTTGGCCGAACATTTAGACGACAGCGTGAACCGAGATTGGGTTGTGGT
GCAAGTAAACCATCAAGGCCGGCAGCCGCAAGCATTAGAAGAGTCTGGCGGTAGTGGTGCAACGACCTAC
AGTAACCAATTTACCTTGATCCCGGCCGATGTAACGTGGCGCGCAACACCACACACCAAGCCGCAAGTGG
ATGGCCCATGCATCGCCCACGTGGTTGGCCCCGATGGCGAAGAGATCTTCTGCGATGAGTATGGCCGCGT
TAAACTGCATTTCCCATGGGACAGATATTCTAACGGCGATGAGCACAGTTCATGTTGGGTGAGGGTGTCG
CAAGGTTGGGCTGGCAGCCAATATGGCATGATGGCTATCCCAAGAATTGGCCATGAAGTGATTGTCGATT
TTTTAAACGGTGATCCGGATCAACCCATAGTCACGGGCCGCGCTTATCACGCCACCAATAAAGCGCCCTA
CACACTGCCAGATAACAAAACCAAAACCGTACTGCGCAGTGAAACCCACCAAGGTGAAGGCTTTAATGAG
CTGAGTTTTGAAGATCAAGCAGGGCAAGAGAAAATCTACCTGCACGCGCAAAAAGACTATGAAGCGCTAG
TGCTTAATGATTCCACCACACACATCAAACACGATAAACACCTGACAGTGGATAACGACCAGTTCAGCCA
CATTAAAAATAACCAACACCTAACGGTTGAGGGCGAAAGCCGTCAGAAAATAGCGTTAGATCGTAGCCTT
GATGTGGGTGGTTCACTGCACCAAAAAATCGGTGAAAAAACGGTTTTTGACTCAGGTAATGAAGTGCACC
TTAAAGCAGGCAATAAGTTGGTGTTAGATGCGGGTAATGAGATCACCATTAAAGCTGCGGGCAGTTTTAT
CAAAGTGGATGGCGGCGGCGTGTACCTAGTCGGGCCTGCGATCAACCTTAACTCCGGTGGCAGCGCAGGC
AGCGGCTCGGGTTATGGCGGTGTTGTAGCGGCGTTGCCACAAGGGGTTGATGAAGCCAAAACGCCGCAAG
ATATTGAGCTAGCAGCGGTAACTCCCACTCAGCAATCCATGTCACCTTTACTTAAGGCGCGACAAATTGA
AGCACTCAAAGGTCCTGCACCTGTGTGTGAAGTGTGTGAAGTGTGTGAAGAGGCCAAGGGAAATTAA
 Primer design