SecReT6
Effector Protein ID: 537455117
SecReT6 ID844
T6SS typeA1
Gene symbol-
Locus tagN175_13435
StrainListonella anguillarum M3
Repliconchromosome II [GenBank: NC_022223] [Browse all T6SS(s) in this replicon]
Location [Strand]2847836..2848354 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0017
DescriptionHcp protein
UniProt IDT1Y094
KEGG IDlag:N175_13435
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.90E-35, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|537455117|ref|YP_008489053.1| hypothetical protein N175_13435 [Listonella anguillarum M3]
MPTPCYISIEGETQGLITAGALSTDSIGDAFVEGHEDQMLVQMFDHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALASGEKMKSVELKWYRTSIEGKQENFFTTKLESASIVDIHCEMPHCQDPANGDFTQ
NVTVSMSYRKILWDHVNAGTSGSDDWRKPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|537452888|ref|NC_022223.1|:c2848354-2847836 Listonella anguillarum M3 chromosome 1, complete sequence
ATGCCAACTCCATGTTATATCTCTATCGAAGGCGAAACTCAGGGTCTCATCACTGCTGGCGCTCTTTCTA
CTGACTCTATCGGCGATGCTTTCGTTGAAGGTCATGAAGATCAAATGTTGGTTCAAATGTTTGACCACGT
TGTGACAGTACCGACTGACCCACAATCAGGTCAGCCTTCTGGTCAACGTGTTCACAAACCATTCAAATTC
ACCGTTGCGCTAAATAAAGCGGTTCCTCTTCTTTATAACGCGTTGGCGTCTGGCGAGAAGATGAAATCGG
TTGAGCTAAAGTGGTACCGCACGTCTATCGAAGGCAAACAAGAGAACTTCTTCACCACTAAACTTGAAAG
CGCGTCTATCGTGGACATTCATTGCGAAATGCCACACTGCCAAGATCCTGCGAACGGCGACTTCACGCAA
AACGTTACGGTTTCTATGTCTTACCGTAAAATCCTGTGGGATCACGTGAACGCGGGTACTTCAGGTTCAG
ATGACTGGCGCAAACCAGTAGAAGCGTAA
 Primer design